SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000040340 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000040340
Domain Number 1 Region: 21-147
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-25
Family SH2 domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000040340   Gene: ENSCAFG00000015458   Transcript: ENSCAFT00000043345
Sequence length 164
Comment pep:known_by_projection chromosome:CanFam3.1:3:69001236:69080263:1 gene:ENSCAFG00000015458 transcript:ENSCAFT00000043345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFHPQRCQSPARYSPQENLLHYKNTSWRKPSPTSSDEKDVQNNDWYIGEHSRQAVEEAL
RKENKDGTFLVRDCSTKSRAEPYVLVVFYGNKVYNVKIRFLEKNQQFALGTGLRGDEKFN
SVEDIIEHYKYFPIILIDGKDKTGIHKEQCYLTQPLPLSRCFSP
Download sequence
Identical sequences J9P461
ENSCAFP00000040340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]