SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000040452 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000040452
Domain Number 1 Region: 21-153
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-46
Family Regulator of G-protein signaling, RGS 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000040452   Gene: ENSCAFG00000030137   Transcript: ENSCAFT00000049109
Sequence length 158
Comment pep:known_by_projection chromosome:CanFam3.1:38:6291940:6309500:-1 gene:ENSCAFG00000030137 transcript:ENSCAFT00000049109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQNCWICKMCGDESKKLPSNITLEEVLQWGQSFEKLMATKYGPVVYAAYLKMEHSDEN
IKFWMACETYKKIASRWSRISRAKKLYKTYIQPQSPREINIDSSTRETIIRNIQEPTQTC
FEEAQKIVYMHMERDSYPRFLKSEMYQKLLKTIQPNNN
Download sequence
Identical sequences J9P4H3
ENSCAFP00000040452 ENSCAFP00000040452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]