SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000040619 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000040619
Domain Number 1 Region: 29-66
Classification Level Classification E-value
Superfamily PH domain-like 0.00000378
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000040619   Gene: ENSCAFG00000031559   Transcript: ENSCAFT00000049057
Sequence length 96
Comment pep:known_by_projection chromosome:CanFam3.1:20:56801545:56801981:1 gene:ENSCAFG00000031559 transcript:ENSCAFT00000049057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPVGGLRRGRRAVRWDRQTAPSAGFMEDPERKYHFECCSEEQCQEWMGALRRASYEFMRR
SLIFYRNEIQKMTGKDPLEQFGISEEARFQLGGLKA
Download sequence
Identical sequences J9P4U6
ENSCAFP00000040619 ENSCAFP00000040619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]