SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000040852 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000040852
Domain Number 1 Region: 628-694
Classification Level Classification E-value
Superfamily F-box domain 0.000000706
Family F-box domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000040852   Gene: ENSCAFG00000015040   Transcript: ENSCAFT00000023871
Sequence length 766
Comment pep:known_by_projection chromosome:CanFam3.1:8:31108071:31190576:1 gene:ENSCAFG00000015040 transcript:ENSCAFT00000023871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFGASVGLRRAALGARSASAVGSEPGLPPPPPPPHRGVQPRARPRAGQERRASVMHLKP
YWKLQKKVSPLEISKETLRTPMTHHEVNDEKCKASYMKPSVFPSPSLGKASSRKPFGIIS
PNVLCSMSGKSPVESSLNVKTKKNAPCATIHQGEEGEGPLDIWAVVKPGNTKEKIAFFAA
HQCSNRIGSMKIKSSWDIDGRATKRRKKSGDLKKAKIQLERMREVNSRCYQPEPFACGIE
HCSVHYVSDSGDGVYTGRPLSVIQMVAFLEQRASALLATCTKNCTNSPSVVRFPGQARGG
LSASEPFSAPGACEESTERGNPEVGEPQSEPIRVLDMVARLESECLKRQSQREPGSLSRN
NSFRRNVGRVLLANGTQANEGKTNKGALEAPDTQVNPVGSVSADHSLSRADHCSPRENES
WDSAPRGCPPLPAGVNFLTDSAKFEPDQQTAMKNGNRYDVEMTEELAGSPFPPRTCPQAI
ELPTDAVDCRSRELAPLTSQNPDQRRKEPLCISITVSKVEQGQPSSLKSCEDPLPGMLFF
LPPGQRQSGCSQLSESTRESPEARQLQDAAEGDSASEEKSVSADAFVPPASPVESTLPVL
EASSWKKQVSHDFLETRFKIQQLLEPQQYMAFLPHHLMVKIFRLLPTKSLVALKCTCCYF
KFIIEYYNIRPADSRWVRDPRYREDPCKQCKKKYVKGDVSLCRWHPKPYCQALPYGPGYW
MCCHRSQKGFPGCKLGLHDNHWVPACHSFNRAIHKKAKGTETEEEY
Download sequence
Identical sequences J9P5C5
ENSCAFP00000040852 XP_005623480.1.84170 ENSCAFP00000040852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]