SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041036 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041036
Domain Number 1 Region: 488-653
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.06e-71
Family A middle domain of Talin 1 0.0000000351
Further Details:      
 
Domain Number 2 Region: 753-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.22e-53
Family I/LWEQ domain 0.000000231
Further Details:      
 
Domain Number 3 Region: 2181-2370
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.04e-50
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 658-782
Classification Level Classification E-value
Superfamily I/LWEQ domain 8.37e-48
Family I/LWEQ domain 0.000000507
Further Details:      
 
Domain Number 5 Region: 1225-1361
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.35e-38
Family VBS domain 0.015
Further Details:      
 
Domain Number 6 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 6.67e-34
Family Second domain of FERM 0.000000558
Further Details:      
 
Domain Number 7 Region: 1775-1867
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.18e-27
Family VBS domain 0.0000124
Further Details:      
 
Domain Number 8 Region: 1075-1207
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.88e-27
Family VBS domain 0.029
Further Details:      
 
Domain Number 9 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 2e-25
Family Third domain of FERM 0.00000822
Further Details:      
 
Domain Number 10 Region: 1410-1555
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000955
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 79-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000201
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 12 Region: 1904-2026
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000104
Family VBS domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000041036
Domain Number - Region: 949-1042
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000549
Family I/LWEQ domain 0.0041
Further Details:      
 
Domain Number - Region: 1691-1771
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00753
Family VBS domain 0.068
Further Details:      
 
Domain Number - Region: 1598-1658
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00863
Family VBS domain 0.078
Further Details:      
 
Domain Number - Region: 1994-2115
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.017
Family I/LWEQ domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041036   Gene: ENSCAFG00000002154   Transcript: ENSCAFT00000045773
Sequence length 2425
Comment pep:known_by_projection chromosome:CanFam3.1:11:52227736:52253858:-1 gene:ENSCAFG00000002154 transcript:ENSCAFT00000045773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEALAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQMGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQSQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLERDLQEVKAAARDGKLKPLP
GETMEKCAQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGEAIATASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTANPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPLQEISHLIEPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHP
QQMALLDQTRTLAESALQLLYTAKEAGGNPKLDEGPMGEPEGSFVDYQTTMVRTAKAIAV
TVQEMIGAHIKHRVQELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLA
ALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVL
VEDTKVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKD
VAKALGDLISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRAL
EATTEHIRQELAPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAI
ADMLRACKEAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQLTGH
SKRVAGSVTELIQAAEAMKGEPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEAD
ESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISA
ARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRL
QAAGNAVKRASDNLVKAAQKAAAFEDQENETVVVKEKMVGGIAQIIAAQEEMLRKERELE
EARKKLAQIRQQQYKFLPSELRDEH
Download sequence
Identical sequences J9P5V6
ENSCAFP00000041036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]