SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041063 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041063
Domain Number 1 Region: 58-99
Classification Level Classification E-value
Superfamily F-box domain 0.0000567
Family F-box domain 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000041063
Domain Number - Region: 259-299
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.011
Family HBL-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041063   Gene: ENSCAFG00000029037   Transcript: ENSCAFT00000044524
Sequence length 368
Comment pep:known_by_projection chromosome:CanFam3.1:7:40168712:40202551:-1 gene:ENSCAFG00000029037 transcript:ENSCAFT00000044524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASEERMAEEGGGGHGDGGPSSAVGSAQRLPPPPPPPAPQPGSQAPPAPALAPDQLPQ
NNTLVALPIVAIENILSFMSYDEISQLRLVCKRMDLVCQRMLNQGFLKVERYHNLCQKQV
KAQLPRRESERRNHSLARHADILAAVETRLSLLNMTFMKYVDSNLCCFIPGKVIDEIYRV
LRYVNSTRAPQRAHEVLQELRDISSMAMEYFDEKIVPILKRKLPGSDVSGRLMGSPPVPG
PSAALTTMQLFSKQNPSRQEVTKLQQQVKTNGAGVTVLRREISELRTKVQEQQKQLQDQD
QKLLEQTQIIGEQNARLAELERKLREVMESAVGSSSGSGANEESPRKRKKAAEAIDSLRK
SKRLRNRK
Download sequence
Identical sequences J9P5Y3
ENSCAFP00000041063 ENSCAFP00000041063 XP_854829.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]