SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041083 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041083
Domain Number 1 Region: 3-392
Classification Level Classification E-value
Superfamily Serpins 1.17e-90
Family Serpins 0.00000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041083   Gene: ENSCAFG00000028728   Transcript: ENSCAFT00000048411
Sequence length 394
Comment pep:known_by_projection chromosome:CanFam3.1:22:637775:663683:-1 gene:ENSCAFG00000028728 transcript:ENSCAFT00000048411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPALLALLLLLLPSCLPGARGGLREDLGLLRTQLALRLYRDTAAAPSNGTNVVISPAGV
SLALEILQFAAQGDTARQLVQALGYSLHAPQVSTSVRSAYAALRSPGRGPQVELACTMFV
HPGAAVSPCFMERVSRWANSSLQPAPPREPRGPPTRSGGGPTGPESGQAEAAWARLALLS
TMSFRSTWRRGFAPADTQPLPFAGVRGLALQVPTMHQTAEVNYGQFQDPVGHQVQVLELP
YLGSTASLLLVRPRDKDTPLSHIEPHLTASVLHTWMSSLTRARMDVFLPRFRIENHFNLK
PILNSWGVTDLFDPLKANLKGISGQDGFYISEAIHKAKMEVSEEGTKASTATALLLLKRS
RIPFFKADRPFFFFLREPDTGFVFSIGRVSNPLD
Download sequence
Identical sequences J9P603
XP_005633900.1.84170 ENSCAFP00000042314 ENSCAFP00000041083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]