SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041205 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041205
Domain Number 1 Region: 2-64,91-411
Classification Level Classification E-value
Superfamily Serpins 1.44e-124
Family Serpins 0.0000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041205   Gene: ENSCAFG00000030335   Transcript: ENSCAFT00000046397
Sequence length 411
Comment pep:known_by_projection chromosome:CanFam3.1:35:3186157:3199690:-1 gene:ENSCAFG00000030335 transcript:ENSCAFT00000046397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALSEANGTFAIRLLKMLCQDDPSRNVFYSPVIISSALAMVYLGAKGNTAAQVARMQNF
IKAPFLSPSYPCHYLPIFSPPPHPVALVLSLSTEKDIHQSFQSLLAEVNKPGTQYLLRTA
NRLFGEKTCEFLPTFKESCVRFYSAELEQLPFAKAAEPSRKHINAWVSEKTEGKIQELLP
GGSIDAKTRLVLVNAIYFKGRWNEQFDKRYTREMPFRINQKEQRPVQMMYQEATFKLAYI
EELQTQVLELPYVGDELSMLILLPDDHVELSSVRVQVESHLTWERFRAWTRPACMRSTDV
EVFLPRLQLGEEYDLAAVLGPLGMADAFQGDKADFSAMSARGDVCLSRFVHRSVLEVDEE
GTAAAAASAALVVAECCSESGPRFCADHPFLFLIRHNAAGSILFCGRFSSP
Download sequence
Identical sequences J9P6C3
ENSCAFP00000041205 ENSCAFP00000041205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]