SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041231 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041231
Domain Number 1 Region: 135-255
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-22
Family Pleckstrin-homology domain (PH domain) 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041231   Gene: ENSCAFG00000010329   Transcript: ENSCAFT00000043088
Sequence length 354
Comment pep:known_by_projection chromosome:CanFam3.1:18:47056683:47120907:-1 gene:ENSCAFG00000010329 transcript:ENSCAFT00000043088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCCTKPPSAQAMKEEAFLRRRFSLCPPSSTPQKVDPRKLSRNLLFGGENELYPLSPGKD
MEPNGPSLPRDEGPPTPSSATKGPPAEYRLYNGSDKECVSPTAKVTKKEALKVQKENYRQ
EKKRATRQLFSALTDPSVVIMADSLKIRGTLKSWTKLWCVLKPGVLLIYKTPKVGQWVGT
VLLHCCELIERPSKKDGFCFKLFHPLDQSVWAVKGPKGESVGSITQPLPSSYLIFRAASE
SDGRCWLDALELALRCSSLLRLSTCKQGRDGEPGSSPDASPPSLCGLPSSAAIHDQDLCP
LNGSSLENDAFSDKSERENAEESDNGTQDPRGKANESGGAHSETPEGPPPRRTT
Download sequence
Identical sequences J9P6E9
ENSCAFP00000041231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]