SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041267 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041267
Domain Number 1 Region: 93-303
Classification Level Classification E-value
Superfamily PH domain-like 6.72e-24
Family Pleckstrin-homology domain (PH domain) 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000041267
Domain Number - Region: 871-964,1033-1130,1179-1227,1461-1517,1569-1625
Classification Level Classification E-value
Superfamily ARM repeat 0.0168
Family PBS lyase HEAT-like repeat 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041267   Gene: ENSCAFG00000010292   Transcript: ENSCAFT00000049496
Sequence length 2199
Comment pep:known_by_projection chromosome:CanFam3.1:25:37962107:38161305:-1 gene:ENSCAFG00000010292 transcript:ENSCAFT00000049496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCTASIVLLQAFRSVVQRSCPHICRRRQEEPSHEILPLESDDEMSRPRTLIIMQEKPRL
LEPLDYETVIEELEKTYRNDPLRDLLFFPSDDFSTATVSWDIRTLYSTVPEDAEHKAENL
LVKEACKFYSSQWHVVNYKYEQYSGDIRQLPRAEYKPEKLPSHSFEVDHEDADKDEDTTS
HSSSKGGGGAGGTGVFKSGWLYKGNFNSTVNNTVTVRSFKKRYFQLTQLPDNSYIMNFYK
DEKISKEPKGCIFLDSCTGVVQNNRLRKYAFELKMNDLTYFVLAAETESDMDEWIHTLNR
ILQISPEGPSQGRRSTELADLGLDSLDNSITCECMPEETESSENSPHPDFAKYLTETEET
VKTTRNMERLNLFSLDPDIDTLKLQKKDLLETDSGIKPFEEKAAKRIMIICKALNLNLQG
CVTENENDPITNIEPFFVSVALYDLRESRKISADFHVDLNHTAVRQMLSGASVALENGNI
DTVTPRQSEEPHIKGFPEEWLKFPKQAIFSVSNPHSEIVLVAKIEKVLMGNIASGAEPYI
KNPDSNKYAQKILKSNRQFFSKLGKYRMPFAWAVRSVFKDNQGSVDRDSRFSPLYRQESS
KISTEDLLKLVSDYRRVDRISKTQTIPGSLDIAVDNVPLEHPNCVTSSFIPVKPFDVTAQ
PEPTVEVEEFVYDSTKYCRPYRVYKNQIYIYPKHLKYDSQKCFNKARNITVCIEFKNSDE
EGAKPVKCIYGKPGGPLFTSAAHTAVLHHSQNPDFSDEVKIELPTQLHEKHHILFSFYHV
TCDINAKANAKKKEMLETSVGYAWLPLMKHDQIASQEYNIPIATGLPPNYLSFQDSASGK
HGGSDIKWVDGGKPLFKVSTFVVSTVNTQDPHVNAFFRQCQKREKDMSQSPTSNFIRSCK
NLLNVEKIHAIMSFLPIILNQLFKVLVQNEEDEITTTVTRVLTDIVAKCHEEQLDHSVQS
YIKFVFKTRACKERTIHEELAKNVTGLLKSNDSTTVKHVLKHSWFFFAIILKSMAQHLID
TNKIQLSRAQRFPESYQNELDNLVMVLCDHVIWKYKDSLEETRRANHSVAKFLKRCFTFM
DRGYVFKMVNNYISMFSSGDLKTLCQYKFDFLQEVCQHEHFIPLCLPIRSANIPDPLTPS
ESTQELHASDMPEYSVTNEFCRKHFLIGILLREVGFALQEDQDIRHLALAVLKNLMAKHS
FDDRYREPEKQAQIASLYMPLYGMLLDNMPRIYLKDLYPFTVNTSNQGSRDDLSTNGGFH
TQSAMKHANSVDTSFSKDVLNSIAAFSSIAISAVNHADSRASLASLDSNPSTNEKSSEKT
DNCEKIPRPLSLIGSTLRFDKLDQAETRSLLMCFLHIMKTISEETLIAYWQRAPSPEVSD
FFSILDVCLQNFRYLGKRNIIRKIAAAFKFVQSTQNNGTLKGSNPSCQTSGPLSQWMHTT
STHEGHKQHRSQTLPIIRGKNALSNPKLLQMLDNTMSSNSNEIDIVHHVDTEANIATEVC
LTILDLLSLFTQIHQRQLQQSECQNSMMKRVFDTYMLFFQVNQSATALKHVFASLRLFVC
KFPSAFFQGPADLCGSFCYEVLKCCNHRSRSTQTEASALLYFFMRKNFEFNKQKSIVRSH
LQLIKAVSQLIADAGIGGSRFQHSLAITNNFANGDKQMKNSNFPAEVKDLTKRIRTVLMA
TAQMKEHEKDPEMLVDLQYSLANSYASTPELRRTWLESMAKIHARNGDLSEAAMCYIHIA
ALIAEYLKRKGYWKMEKICTPSLLPEDIHPCDSYPLLTAPGGGSMFSMGWPAFLSITPNI
KEEGAMKEDSGMQDTPYNEHILVEQLYMCVEFLWKSERYELIADVNKPIIAVFEKQRDFK
KLSELYYDIHRSYLKVAEVVNSEKRLFGRYYRVAFYGQGFFEEEEGKEYIYKEPKLTGLS
EISQRLLKLYADKFGADNVKIIQDSNKVNPKDLDPKYAYIQVTYVTPFFEEKEIEDRKTD
FEMHHNINRFVFETPFTLSGKKHGGVEEQCKRRTVLTTSHLFPYVKKRIQVISQSSTELN
PIEVAIDEMSKKVSELNQLCTMEEVDMIRLQLKVQGSVSVKVNAGPMAYARAFLEETNAK
RYPDNQVKLLKEIFRQFADACGQALDVNERLIKEDQLEYQEELRSHYKDMLSELSTIMNE
QIMCRDDPSKRGAERTCPPVVSRAPPALPTVSISPSDEV
Download sequence
Identical sequences J9P6I4
XP_005635805.1.84170 ENSCAFP00000015158 ENSCAFP00000041267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]