SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041484 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041484
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-23
Family PDZ domain 0.0000086
Further Details:      
 
Domain Number 2 Region: 488-590
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-23
Family PDZ domain 0.01
Further Details:      
 
Domain Number 3 Region: 277-380
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-18
Family PDZ domain 0.033
Further Details:      
 
Domain Number 4 Region: 760-870
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000011
Family Nucleotide and nucleoside kinases 0.0013
Further Details:      
 
Domain Number 5 Region: 591-663
Classification Level Classification E-value
Superfamily SH3-domain 0.000000326
Family SH3-domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041484   Gene: ENSCAFG00000001902   Transcript: ENSCAFT00000048763
Sequence length 1174
Comment pep:known chromosome:CanFam3.1:1:88126136:88230654:-1 gene:ENSCAFG00000001902 transcript:ENSCAFT00000048763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVLPGGPADGLLQEND
RVVMVNGTPMEDVLHSFAVQQLRKSGKIAAIVVKRPRKVQLAPPQGSLPVDEDDRAFEVM
DEFDGRSARSGYSERSRRSSHGGRSRSWEDSPERGRPHERAWSQERERSRGRSLERGLDH
DDDYRRPRERSRGRSLERGLDHDDDYGRPGERSHGMSTDRGYDRGYDRGYDRGYDRTYSP
EAEYGRRAQPDARHAGSRSRSREHLRSRSPSPELRGRPDHAGQPDSDRPIGVLLMKSKAN
EEYGLRLGSQIFIKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGK
LQLVVLRDSKQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRQQYSDYDYHSSNEKLK
ERPNSREDMQNRWSRMGATPTPFKSMGDIASVVGTENSKEPRYQEEPPAPQPKAAPRTFL
RPSPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQIL
KVNTQDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILACGRGDSFFIRSHFECE
KETPQSLAFSRGEVFRVVDTLYDGKLGHWLAVRIGNELEKGLIPNKSRAEQMASVQNAQR
DNAGDRADFWRMRGQRSGMKKNLRKSREDLTAAVSVSTKFPAYERVLLREAGFKRPVVLF
GPIADIALEKLANELPDLFQTAKTEPKDAGSEKSSGVVRLNTVRQIIEQDKHALLDVTPK
AVDLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLYDQANKLKKTCAHLFTA
TINLNSANDSWFGSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDRMSYLTAMGADYLSCDS
RLISDFEDTDGEGGAYTDNELDEPAEEPLVSSITRSSEPVQHEESIRKPSPEPRAQMRRA
ASRDQLRDSSPPPAFKPEPPKAKTQNREESFDISRSHDYKSNPSAVAGNEVSGASTRSCP
PPIAAKPSFGRSILKPSTPVPSPESEEVGEGSEEQEGAPKSVLGKVKIFEKMDHKARLQR
MQELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGLSQHTSSRPPEPQKGPSRLYQDPRGS
YGSDAEEEEYRQQLSEHSKRGYYSQPSRYRDTEL
Download sequence
Identical sequences J9P749
XP_005615782.1.84170 ENSCAFP00000041484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]