SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041566 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041566
Domain Number 1 Region: 663-839
Classification Level Classification E-value
Superfamily Macro domain-like 1.48e-44
Family Macro domain 0.000077
Further Details:      
 
Domain Number 2 Region: 1054-1246
Classification Level Classification E-value
Superfamily Macro domain-like 3.2e-42
Family Macro domain 0.00076
Further Details:      
 
Domain Number 3 Region: 863-1043
Classification Level Classification E-value
Superfamily Macro domain-like 4.88e-41
Family Macro domain 0.00019
Further Details:      
 
Domain Number 4 Region: 1475-1595
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.3e-24
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.035
Further Details:      
 
Domain Number 5 Region: 1348-1456
Classification Level Classification E-value
Superfamily WWE domain 3.01e-19
Family WWE domain 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000041566
Domain Number - Region: 88-159
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00243
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041566   Gene: ENSCAFG00000011970   Transcript: ENSCAFT00000043176
Sequence length 1605
Comment pep:known_by_projection chromosome:CanFam3.1:33:25769327:25801465:1 gene:ENSCAFG00000011970 transcript:ENSCAFT00000043176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDTSEECENTSSLVAFENLKANVTDIMLILLVENVSGLSSNDFKVEVLRDFDVAVVTFQ
THTDAVKFVDDCARHHSVKQLQLSPRLLEVTKTIRVENLPPGVNDYNLKCLFENPQNGGG
RVASIECFPEESSALIEFFDKKVLHTIVTKKLEFKHMPLSVFPYYTSLGTALYGKEKPLI
KLPAPFREPLDLPLWRFLQQKNHLIKEINDEARRCHCELIWSKLSAEVTIRPATTLFCLG
RLKIRTWREDVSMAFSSIRSKYKVTTLTVDPTVWDTVRNHLEDDRILIEFDTLTGTVTLV
GKSEDVQNMEPQIKELIESTVQKIKREEQSLEEKVALSPGRYSLLCHSNALEHLRTECPE
VEMCFDKASQHMCFKGFHADVNKAKCEIQKKMDIMVQKSIELPPEIFQFLQQVDCVEFSK
SLLVAQKILAVYELAGTAVVLTGYSSAVLSDAAKQMVTALSYKRLDLKDGEVLKGRKWKG
LTHSLHRRHNSPSRTVIIDELTSETKAEVVIAGCTSQVNETYSLLFSFVEKHMRVERLIE
IEPPIVIDYLRREKKLCWQKMKRTNVQVIFNPENRAQGVLLIGPQARVLEGVSLLGQVRE
AVRVESLQVHTPGASRLFREKAPYYRSEVQRRFGCCLELQEAAGAAGRGDAHRGLPRVEL
RPGVALAVQRGDLTRFPAAQAVVSPASGDLQLRGGLAAALAQAAGPALQEDCSRLLRTAG
PVPVGGAVASTAGKLPYRLVIHAVGPQWKDSEASRCVSQLKAAVKQSLRLAEAHGCRSVA
IPAISSGLFGFPLAVCVRTIVLAVQESCQLSHDGHALKEIYLVDTAEKTVQAFADTVTAL
AEVPGPAAVQPGPTGVHASGQVSLSQGNLRVLLVKGDAQRAAADVIVNSVPVNLKLNRGL
LSQALLEKAGPKLQEELDMVGRAVAVGMGTVLQTSGCDLHCRYVLHVVAPDWEEGSTSSQ
KIMRDIIRKCLEITESLSLRSIAFPAIGTGNLGFPKTIFAELITSEVLTFSSKTQLAALQ
EVQFLLHPNDHENIQAFSHVFARRTNGNVVSDTIPKAEDAQGSYGTVSSPNVDMHEMKIG
PIIFQVASGDITKEEADVIVNSTSKTFNLKAGVSKAILKCAGQNVEMACSLLAQTGNSDY
IVTEGGLLKCKNIIHVIGGNDVKKSISFVLQECEKRNYSSICLPAIGTGNAQKDPDKVAD
AIIDAIEDFIQKGMLKSVKKVKVVIFLPHLLDVFYDSMKKREASQASPQQSLESKLKSSV
SSPSQSPQKQNPLVLKKKTESATFQVCGENVKCMKNALSWIQDLITKELCPYTNEDECIK
DFNEKEYHKLNELQENLNIAICLDSERPLIEVFGTGNDLTQARNAIEEMIKGIRLAKEQK
SQADFISEFIEWQYYNNGTFHSFDKITNLQLENARKAKKRTTLVKVNHKSYTVDLVTNIA
TDTKGHHLPVKRFMKSEVVIPEHWSDMKQQDVCVVELQPGHAEYDTVATKFNQTCSHLYI
EKIERIQNPHLWNSYQTKKKAMDAKNGHKNNEKQLFHGTDADSVPHVNHNGFNRSYAGKN
AVAYGKGTYFAVNARYSANDTYSRPDINGKKHMYYLFLRSRDPCH
Download sequence
Identical sequences J9P7C9
ENSCAFP00000041566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]