SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041688 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041688
Domain Number 1 Region: 14-301
Classification Level Classification E-value
Superfamily Ras GEF 4.58e-80
Family Ras GEF 0.0000351
Further Details:      
 
Domain Number 2 Region: 454-578
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041688   Gene: ENSCAFG00000020156   Transcript: ENSCAFT00000046999
Sequence length 585
Comment pep:known_by_projection chromosome:CanFam3.1:9:56079708:56374998:-1 gene:ENSCAFG00000020156 transcript:ENSCAFT00000046999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVSPEEFASQITL
MDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAE
ILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSK
EDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRII
ADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKE
DLAGPSTGSSSARFSRRPTCPDASVAGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSAT
FPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLESRGRL
YATLGPNWRVPVRNSPRTRSCVYSPTGPCICTLGSSAAVPTMEGPLRRKTLLKEGRRPAL
SSWTRYWVILSGSTLLYYGAKSLRGTDRKHYKSTPGKKVSVVGWMVQLPDDPEHPDIFQL
NNPDKGNVYKFQTGSRFHAILWHKHLDDACKSNRPQVPANLMSFE
Download sequence
Identical sequences J9P7P9
ENSCAFP00000029901 ENSCAFP00000041688 XP_851594.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]