SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000041923 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000041923
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-24
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000041923   Gene: ENSCAFG00000019613   Transcript: ENSCAFT00000042971
Sequence length 524
Comment pep:known_by_projection chromosome:CanFam3.1:X:122744039:122822869:-1 gene:ENSCAFG00000019613 transcript:ENSCAFT00000042971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGDAVCTGWLVKSPPERKLQRYAWRKRWFVLRRGRMSGNPDVLEYYRNKHSSKPIRVI
DLSECAVWKHVGPGFVRKEFQNNFVFIVKTTSRTFYLVAKTEVEMLVWVYSISQVCNLGH
LEDGAGAPESLRGKSRADARPTSSRGLGQATGTGSTLQARMPYTLNVTGRRRRSEADFLS
LSYYLVLSTCKSGRTRHASLPSRCDSWPHAERPPEPTSCDDVFVACAPPPRSSPRPDGSA
RAPREPDPAPRTPPPRPPKPSHLSERRQDAQPEGAAASRRVSLSGLDNVRTRRADVEGQS
LRHRDKRLSLNLPRRLSPARPPACAGPGDGYVPMGPQAGARVAGAPCSRDDYMAMSPGSL
CGPLPELPADLEPPPVNRDLKPQRRPRPPPLDLRNLSTIREHASLTRTCTVPCNRTRFLS
PERNGINSARFFADSVSREEEESYIQMENHRTANPLGSGALTWTKKFSLDYLALDFNSAS
PAPVQQKLLLAEEQRVDYVQVDEQKTQALQSTKQEWTDERQSKV
Download sequence
Identical sequences J9P856
ENSCAFP00000041923 ENSCAFP00000041923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]