SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042012 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042012
Domain Number 1 Region: 45-234
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.06e-66
Family Regulator of G-protein signaling, RGS 0.000000019
Further Details:      
 
Domain Number 2 Region: 457-684
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-61
Family DBL homology domain (DH-domain) 0.000000609
Further Details:      
 
Domain Number 3 Region: 687-820
Classification Level Classification E-value
Superfamily PH domain-like 2e-37
Family Pleckstrin-homology domain (PH domain) 0.0000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042012   Gene: ENSCAFG00000030005   Transcript: ENSCAFT00000042928
Sequence length 976
Comment pep:known chromosome:CanFam3.1:1:112391574:112410035:-1 gene:ENSCAFG00000030005 transcript:ENSCAFT00000042928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEADNVARGLAPGPPRPGLVPVSIIGAEDEDFENELETNTEEQNSQFQSLEQVKRRPAHL
MALLQHVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFCHCFLDKTAVLRVLVPPAVA
FELDRTRPEVISEDLQRQFVQEVVQSQQAAVSRLLEDFRSKRLMGMTPWEQDLTQLEAWV
GRDRASFEARERHLAERLLAHLEEMQHTISNDEEKSAAVVNAISLYMRHLGVRTKSGDKK
SGMNFFRKKVMGNRRSDEPTKTKKGLSIFLDPARWNRGEPQASDFRHLKVETDAEKPGLT
ERKGGLGVPSRDRNVGAPGQDVPGVSLHPLPGDSPDREPGVDTPPELGDPPPQGPASLEP
PGPSESTEEGPDTERRWKRLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMD
PSSATAVLGPARRATPEPGDEGDPGRSGLELEPEEPPGWRELIPPGTLHSLPKSQVKRQE
VISELLVTEAAHVRMLRVLHDLFYQPMLEGNFFSTEDLQNIFPSLDELIEVHSLFLDRLM
KRRQDSGCLIEEIGDVLLARFDGAEGKWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAF
VQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEESAEREKVELAAECCREIL
HHVNQAVRDMEDLLRLKDYQKRLDLSLLRQSSDPMLSEFKNLDITKKKLIYEGPLTWRLT
KDKAVEVHVLLLDDLLLLLQRQDDRLLLKSHSRTLTPTPDGKTMLRPVLRLTSAITREVA
TDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCSLITETAGSLKVPAPASRPKPRPSPSS
TREPLLSSSENGNGGGREMPPADGQTERILSTLLPYCRPRPEGQLAAKALEKVLSLKQLL
FPSEEDSGAGPPQEGDGVPGGGPLNPTQTHTQEIREKLLSLEETMKQLEEVEEEFCHLRL
LLSQLGENSTPQPGCT
Download sequence
Identical sequences J9P8E3
ENSCAFP00000041370 XP_013975552.1.84170 ENSCAFP00000042012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]