SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042089 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042089
Domain Number 1 Region: 268-370,529-625
Classification Level Classification E-value
Superfamily RNI-like 7.85e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.059
Further Details:      
 
Domain Number 2 Region: 145-238
Classification Level Classification E-value
Superfamily F-box domain 2.49e-19
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042089   Gene: ENSCAFG00000015321   Transcript: ENSCAFT00000044526
Sequence length 636
Comment pep:known_by_projection chromosome:CanFam3.1:3:64692677:64727539:1 gene:ENSCAFG00000015321 transcript:ENSCAFT00000044526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNECEQLNYAKQLKER
LEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWN
QAEERQKFFKYSVDEKSDKEAEVSEQSTGITHLPPEVMLSIFSYLNPQELCRCSQVSTKW
SQLAKTGSLWKHLYPVHWARGDWYSGPATELDTEPDEEWVKNRKDESRAFQEWDEDADID
ESEESAEESIAISIAQMEKRLLHGLIHNILPYVGTSVKTIVLAYSSAVSSKMVRQILELC
PNLEHLDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTSYQ
SGLLKTSTSKITSTSWKNKDITMQSTKQYACLHDLTNKGIGEEMDNEHPWTKPVSSESFT
SPYVWMLDAEDLADIEDAVEWRHRNVESLCVMETASNFSCSSSGCYSKDIVGLRTSVCWQ
QHCASPAFAYCGHSFCCTGTALRTMSALPESSALCKKASRTRLLRGKDLIYSGSEKSDQE
TGRVLLFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTVTGAGLQDLVSACPSLN
DEYFYYCDNINGPHADTASGCQNLQCGFRACCRSGE
Download sequence
Identical sequences J9P8L0
ENSCAFP00000042089 XP_005618621.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]