SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042137 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042137
Domain Number 1 Region: 148-439
Classification Level Classification E-value
Superfamily Serpins 1.57e-80
Family Serpins 0.000000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042137   Gene: ENSCAFG00000015271   Transcript: ENSCAFT00000046743
Sequence length 461
Comment pep:known_by_projection chromosome:CanFam3.1:26:30689376:30694495:-1 gene:ENSCAFG00000015271 transcript:ENSCAFT00000046743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILKWLRTDTLRASSWVKAMGLPSKHCGGRSTRLPLTVSLVFSPNFSFAKMKCLFQPLII
SLILTSMCANNSLAGQLEEGGEDSPSRDSQWRQLNSKNLSMSLLPADFHKENTVTNDWIT
EGEEDEDYLDLEKIFSEDDDYIDIIDAVSPTDSEAVAGNILQLFQGKSRIQRLNILNAKF
AFNLYRALKEQAHSTDNIFIAPVGISTAMGMISFGLQGETYEQVHSILHFKDFVNASSKY
EIMTIHNLFRKLTHRLFRRNFGYTLRSVNDLYVQKQFPILDDFKRKVREYYFAEAQEADF
SDPAFISKTNNHILKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNF
RLNEREAVKVSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKLSGMKTLEAQL
TPQVVERWQKSMTNRYFRLNVCSFDLWEAGRDQKHWEFWSF
Download sequence
Identical sequences J9P8Q8
ENSCAFP00000042137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]