SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042170 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042170
Domain Number 1 Region: 108-239
Classification Level Classification E-value
Superfamily Cyclin-like 4e-42
Family Cyclin 0.0001
Further Details:      
 
Domain Number 2 Region: 242-362
Classification Level Classification E-value
Superfamily Cyclin-like 1.54e-33
Family Cyclin 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042170   Gene: ENSCAFG00000009965   Transcript: ENSCAFT00000047382
Sequence length 373
Comment pep:novel chromosome:CanFam3.1:32:15203124:15204334:1 gene:ENSCAFG00000009965 transcript:ENSCAFT00000047382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAKWVPLSSTAASKPGLRPRTALGDIGNKVSEQPQAKVPLKKEAKTLVPGKVIAKKIP
KPLPILVDTPSPSPMETSGCASAEEYLCQAFSDVILAGNDVGAEDGADPNLCSEYVKDIY
AYLRQLEEEQAVKPKHLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTLSIIDRFMQ
NNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTHTKHQIRQMEMKILRSLNFGLG
RPLPLHFLRRAPKIGEVDVEQHTLAEYLMEHISMLDYDMVHFPPSQIAAGAFCLALKILD
NGEWTPTLQHYLSYTEESLLNVMQHLAKNIVMANRGLTKHMTIKNKYAISKHAKISTLTQ
LNSAGVQDLTEAV
Download sequence
Identical sequences J9P8T9
ENSCAFP00000042170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]