SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042205 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042205
Domain Number 1 Region: 85-250
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.31e-38
Family CRAL/TRIO domain 0.0022
Further Details:      
 
Domain Number 2 Region: 318-457
Classification Level Classification E-value
Superfamily PapD-like 1.44e-37
Family MSP-like 0.00000024
Further Details:      
 
Domain Number 3 Region: 24-83
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000116
Family CRAL/TRIO N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042205   Gene: ENSCAFG00000011879   Transcript: ENSCAFT00000049785
Sequence length 486
Comment pep:known_by_projection chromosome:CanFam3.1:X:11147537:11201079:1 gene:ENSCAFG00000011879 transcript:ENSCAFT00000049785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYHAQNKAKLISETRRRFEAEYVTDKPDKYDPRDVERLQQDDNWVESYLLWRHNVVDE
TLKMLDESFQWRKEMSVNDLTESSIPRWLLEIGGIYLHGYDKEGNKLFWIRVKYHVKDHK
TMLDKKKLIAFWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLS
KMVIFDMPWIMNAAFKIVKSWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYS
YPPLVDDDFQTPLCENGPIASEDEASSKEDIESDGKETLETVSNEEQTTLLKKINVTEHT
SKAEENEKVDSKMKAFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNVV
AFKVRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQSSGTGP
AELTQFWKEVPRNKVMEHRLRCHIVESSKPTTLTLKDSGFNMSDKTSEDLYLQFATSRRE
NDFSTP
Download sequence
Identical sequences J9P8X4
XP_005641185.1.84170 ENSCAFP00000042205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]