SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042257 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042257
Domain Number 1 Region: 78-277
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-48
Family DBL homology domain (DH-domain) 0.0000000819
Further Details:      
 
Domain Number 2 Region: 270-393
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-35
Family Pleckstrin-homology domain (PH domain) 0.00000221
Further Details:      
 
Domain Number 3 Region: 9-78
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-24
Family SH3-domain 0.0000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042257   Gene: ENSCAFG00000018952   Transcript: ENSCAFT00000047224
Sequence length 622
Comment pep:known_by_projection chromosome:CanFam3.1:X:107029681:107100021:-1 gene:ENSCAFG00000018952 transcript:ENSCAFT00000047224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTENGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYV
REIKSSERPLSPKAVKGFETTPLTKNYYTVVLQNILDTEKDYAKELQSLLVTYLRPLQSN
NNLSTVEFTSLLGNFEEVCSFQQTLCQALEECSKFPENQHKVGGCLLNLMPHFKSMYLAY
CANHPSAVNVLTQHSDDLEQFMESQGASSPGILILTTSLSKPFMRLEKYVTLLQELERHM
EDTHPDHQDILKAIIAFKTLMGQCQDLRKRKQLELQILSEPIQAWEGENIKTLGNVLFMS
QVMMQYGTSEEKEERYLMLFSSVLILLSASPRMSGFIYQGKIPVAGMVVTRLDEIEGNDN
TFEITGNMVDRIVIHCNNSQDFQEWLEQLYRLIRGPASCSSLSKTSSSSCSAHSSFSSTG
QPRGPLEPPQIIKPWSLSCLRPAPPLRPSAALGYKERMSYILKESSKSPKTMKKFLHKRK
TERKPSEEEYVIRKSTAALEEDAQILKVIEAYCTSANFQQGHGSSARKDSLPQVLLPEEE
KLIIEETRSNGQTIIEEKSLVDTVYALKDEVKELKQENKRMKQCLEEELKSRRDLEKLVR
RLLKQTDECIRAESSSKTSILP
Download sequence
Identical sequences J9P925
ENSCAFP00000042257 XP_013967190.1.84170 XP_013967191.1.84170 XP_013967192.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]