SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042314 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042314
Domain Number 1 Region: 3-370
Classification Level Classification E-value
Superfamily Serpins 3.28e-84
Family Serpins 0.00000503
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042314   Gene: ENSCAFG00000028728   Transcript: ENSCAFT00000048980
Sequence length 373
Comment pep:known_by_projection chromosome:CanFam3.1:22:523240:663596:-1 gene:ENSCAFG00000028728 transcript:ENSCAFT00000048980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLRTQLALRLYRDTAAAPSNGTNVVISPAGVSLALEILQFAAQGDTARQLVQALGYSLHA
PQVSTSVRSAYAALRSPGRGPQVELACTMFVHPGAAVSPCFMERVSRWANSSLQPAPPRE
PRGPPTRSGERCGGCRGEAGRSGGPTGPESGQAEAAWARLALLSTMSFRSTWRRGFAPAD
TQPLPFAGVRGLALQVPTMHQTAEVNYGQFQDPVGHQVQVLELPYLGSTASLLLVRPRDK
DTPLSHIEPHLTASVLHTWMSSLTRARMDVFLPRFRIENHFNLKPILNSWGVTDLFDPLK
ANLKGISGQDGFYISEAIHKAKMEVSEEGTKASTATALLLLKRSRIPFFKADRPFFFFLR
EPDTALTVFFDKV
Download sequence
Identical sequences J9P981
ENSCAFP00000042314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]