SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042395 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042395
Domain Number 1 Region: 42-159
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-35
Family Phosphotyrosine-binding domain (PTB) 0.00065
Further Details:      
 
Domain Number 2 Region: 455-533
Classification Level Classification E-value
Superfamily SH3-domain 7.74e-19
Family SH3-domain 0.00058
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000042395
Domain Number - Region: 539-595
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000275
Family Pointed domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042395   Gene: ENSCAFG00000019805   Transcript: ENSCAFT00000043623
Sequence length 602
Comment pep:known_by_projection chromosome:CanFam3.1:6:42168497:42177012:1 gene:ENSCAFG00000019805 transcript:ENSCAFT00000043623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWDLLSNKAKNVPSPSAAFPPTPTPSRHHLWAPDPNLLSPQHLMTCKLGSQKIQEPKDA
LKKLQEMDAQGRVWSQDLFLQVRDGWFQLLDIETKEELDSYRLDSIQAMDVVLSIGSYNA
ILSITVQESSLPATSTLLFHCQEVRAEQLRNSLKKALEEEQQQRPHSRARHPSQDRWRGP
SPERSFSKEQVPPPEQGLPPEQSYWMTPEHSTPPSPRPLLRNSSTQESSTLTLPPPRRTP
SPESPERDEEILSHVLRDIELFVGKLKEAQAKSSHKKKKLGKKKGKDQWGMTQAQYIDCF
QKIKYSFNLLGKLAIWLQEKNAPEFVHILFQLLDSILAQCPEPGLAARVISPLLTPKAID
LLQSCLSPAESNFWKRLGAAWTTSRANWTGSEPPPYQPTFYDGWQLPEPSNQAPSGYQSS
TSLRPGLGSTSYLAQEETHNHGPQPGDPNHVPSSSRPMKPALKMQVLYEFEARNPQELTV
AQGEVLEVLDQSKRWWLVKNEKGQSGYIPSNILEPLQSRAPGDQSQSPSWAPVLRPSSTP
EEVAAWLQAQNFSTTTVKSLRFLTGSQLLRMRPGELQMLCPQEAPRVLAQLENVRRTLGM
SL
Download sequence
Identical sequences J9P9G2
ENSCAFP00000042395 ENSCAFP00000042395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]