SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042487 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042487
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.38e-30
Family Calponin-homology domain, CH-domain 0.0000984
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042487   Gene: ENSCAFG00000032558   Transcript: ENSCAFT00000044698
Sequence length 280
Comment pep:novel chromosome:CanFam3.1:X:41430051:41430922:1 gene:ENSCAFG00000032558 transcript:ENSCAFT00000044698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSAHFNQGPAYRLSVEAKNKLQKYDHQCEQEIRECIEEVTGHCISNNLMDSLKDGIILC
KCISKLPGPMKKVSESTQNGHQLENIGNFKITKYRVKPHDIFEASDLFENTSHTQVQFIL
TALASMAKMKGNKVNIGVKYAEEQELKFELGKLREGQSIIGLQMGTNKFASQQGTMAYGS
QHYLCDPRLGQHQPLDKGASQASLTVLGTKTIFKSGLGMEHCDIFNTSLQMGSNKGASQQ
GMTAYRLLCQVYDPYGCLTPEYLDLGEPAHNHHPNYYNSA
Download sequence
Identical sequences J9P9Q4
ENSCAFP00000042487 ENSCAFP00000042487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]