SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042606 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042606
Domain Number 1 Region: 23-216
Classification Level Classification E-value
Superfamily Sec7 domain 2.75e-79
Family Sec7 domain 0.00000000624
Further Details:      
 
Domain Number 2 Region: 224-338
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-34
Family Pleckstrin-homology domain (PH domain) 0.000000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042606   Gene: ENSCAFG00000015701   Transcript: ENSCAFT00000045954
Sequence length 467
Comment pep:known_by_projection chromosome:CanFam3.1:6:11557554:11578729:-1 gene:ENSCAFG00000015701 transcript:ENSCAFT00000045954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPCAWRKLWLTISSLFEMHSKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQNSPED
VAQFLYKGEGLNKTVIGDYLGERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPG
EAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFVT
MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKT
WKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIK
ACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIRCVPQAPAQSPRAPSCPRVCAPARV
EGHACKCTCACGSAHPCECMPVHVGVHEWECLHVGVHTRVGVHAWECTRMSVYACMRWSA
CTGAALPERMHTCVPGLTPGCRDALQPPSALRIVLCPQSKHQQGSLL
Download sequence
Identical sequences J9PA23
ENSCAFP00000042606 ENSCAFP00000042606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]