SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042611 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042611
Domain Number 1 Region: 526-707
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.12e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0058
Further Details:      
 
Domain Number 2 Region: 682-803
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.45e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 3 Region: 1-85
Classification Level Classification E-value
Superfamily PH domain-like 2e-21
Family Phosphotyrosine-binding domain (PTB) 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000042611
Domain Number - Region: 80-141
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0445
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042611   Gene: ENSCAFG00000005044   Transcript: ENSCAFT00000043637
Sequence length 933
Comment pep:known_by_projection chromosome:CanFam3.1:22:29109011:29175814:-1 gene:ENSCAFG00000005044 transcript:ENSCAFT00000043637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFQVGRFEINLISPDTKSVVLEKNFKDISSCSQGIKHVDHFGFICRESPEPGLSLYICY
VFQCASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRA
KLVIQRHLSSLTDNEQADIFERVQKMKPVSDQEENELVILHLRQLCEAKQRTHIHIGEGP
STISNSTIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSMDSFERSN
SLASEKDYSPGDSPPGTPPASPLSSAWQTFPEEDSDSPQFRRRAHTFSHPPSSTKRKLNL
QDGRAHGVRSPLLRQSSSEQCSILPSGRRMHKESNSSSSLPSLHTSFSAPSFTAPSFLKS
FYQNSGRLSPQYENEISDGEGRKRTSSTCSNESLNAGGTPVTPRRISWRQRIFLRVASPM
NKSPSAMQQDGLDRSELLPLSPLAPTMEEEPLVIFMSGEDDPEKSEERKKAEELRSLWRK
AIHQQILLLRMEKENQKLEASRDELQSRKVKLDYEEVGVCQKEVLITWDKKLLNCRAKIR
CDMEDIHISLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDISYKELLKQLTAQQHA
ILVDLGRTFPTHPYFSAQLGAGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLLLHMSEE
QAFEMLKFLMYDQGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEISPSLYAA
PWFLTLFASQFPLGFVARVFDIIFLQGTEVIFKVALSLLSSQETLIMECENFESIVEFLK
TTLPDMNASEMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYACEDSEPMEKLERA
NSQLKRQNMDLLEKLQIAHAKIQTLESNLENLLTRETKMKSLIRTLEQEKMAYQKTVEQI
RKLLPADALANCESLLRDLNCNPNNKAKAGNKP
Download sequence
Identical sequences J9PA28
ENSCAFP00000042611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]