SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042655 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042655
Domain Number 1 Region: 102-215
Classification Level Classification E-value
Superfamily PH domain-like 8.73e-28
Family Phosphotyrosine-binding domain (PTB) 0.038
Further Details:      
 
Domain Number 2 Region: 8-121
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000017
Family Pleckstrin-homology domain (PH domain) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042655   Gene: ENSCAFG00000014622   Transcript: ENSCAFT00000044952
Sequence length 217
Comment pep:known_by_projection chromosome:CanFam3.1:3:60866112:60897257:-1 gene:ENSCAFG00000014622 transcript:ENSCAFT00000044952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEAALVEGQVKLRDGKKWKTRWLVLRKPSPVADCLLMLAYKDKSERAKGLRERSSLTLE
DICGLEPGLPYEGLAHTLAIICLSQAVMLGFDSREAMCAWDARIRYALGEVHRFHVTVAP
GTKLESGPATLHLCNDVLVVARDIPPAVMGQWKLSDLRRYGAVPNGFIFEGGTRCGYWAG
VFFLSSAEGEQISFLFDCIVRGISPTKGPFGLRPVLP
Download sequence
Identical sequences J9PA72
ENSCAFP00000042655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]