SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042731 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042731
Domain Number 1 Region: 397-505
Classification Level Classification E-value
Superfamily PDZ domain-like 6.44e-25
Family PDZ domain 0.0033
Further Details:      
 
Domain Number 2 Region: 5-100
Classification Level Classification E-value
Superfamily PDZ domain-like 6.05e-22
Family PDZ domain 0.0000856
Further Details:      
 
Domain Number 3 Region: 155-258
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-19
Family PDZ domain 0.025
Further Details:      
 
Domain Number 4 Region: 678-788
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000835
Family Nucleotide and nucleoside kinases 0.001
Further Details:      
 
Domain Number 5 Region: 506-582
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000604
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042731   Gene: ENSCAFG00000010407   Transcript: ENSCAFT00000046974
Sequence length 1743
Comment pep:known chromosome:CanFam3.1:3:38994466:39233349:-1 gene:ENSCAFG00000010407 transcript:ENSCAFT00000046974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQEN
DRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPDPEPVSENEDSYD
EEVHDPRSSRGGLVSRRSEKSWARDRSASRERSLSPRSDRRSVASSQPPKPTKVTLVKSR
KNEEYGLRLASHIFVKEISQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIERSK
GKLKMVVQRDERATLLNVPDLSDSIHSANASERDDISEIQSLASDHSGRSHDRPPRHSRS
RSPDQRSEPSDHSRHSPQQPSSGSLRSREEERISKPGAVSTPVKHADDHTHKTVEEVVVE
RNEKQAPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRPSMKLVKFRKGDSV
GLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDLPKG
EEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGK
LGSWLAIRIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRN
LRKSREDLSAQPVQTKFPAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIAK
SEPRDAGTDQRSSGIIRLHTIKQIIDQDKHALLDVTPNAVDRLNYAQWYPIVVFLNPDSK
QGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQ
QNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAY
TDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSPQAQPQPIHRIDSP
GFKTASQQKAEASSPVPYLSPETNPASSTSAVNHNVTLTNVRLEGPTPAPSTSYSPQADS
LRTPSTEAAHIMLRDQEPSLPSHVEPAKVYRKDPYPEEMMRQNHVLKQPAVGHPGQRPDK
EPNLSYESQPPYVEKQANRDLEQPTYRYDSSSYTDQFSRNYDHRLRYEERIPTYEEQWSY
YDDKQPYQPRPSLDNQHPRDLDSRQHPEESSERGYYPRFEEPAPLSYDSRPRYDQPPRTS
TLRHEEQPTPGYDMHNRYRPEAQSYSSAGPKASEPKQYFDQYPRSYEQVPSQGFSSKAGH
YEPLHGAAVVPPLIPASQHKPEVLPSNTKPLPPPPTLTEEEEDPAMKPQSVLTRVKMFEN
KRSASLENKKDENHTAGFKPPEVASKPPGAPIIGPKPTPQNQFSEHDKTLYRIPEPQKPQ
MKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPSTHIPAGHLSEPAKPVHSQNQT
NFSSYSSKGKSPEADAPDRSFGEKRYEPVQATPPPPPLPSQYAQPSQPGTSSSLALHTHA
KGAHGEGNSISLDFQNSLVSKPDPPPSQNKPATFRPPNREDTVQSTFYPQKSFPDKAPVN
GAEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHKPDLSSKAPASP
KTLAKAHSAAQPPEFDSGVETFSIHADKPKYQMNNLSTVPKAIPVSPSAVEEDEDEDGHT
VVATARGVFNNNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGE
TLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSSGMLSSLCPLGALGT
VID
Download sequence
Identical sequences J9PAE7
ENSCAFP00000042731 ENSCAFP00000015301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]