SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000042807 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000042807
Domain Number 1 Region: 742-953
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-53
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 1418-1658
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000201
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 945-1042
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000529
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000042807   Gene: ENSCAFG00000005619   Transcript: ENSCAFT00000047227
Sequence length 1743
Comment pep:known_by_projection chromosome:CanFam3.1:21:24858333:24918693:-1 gene:ENSCAFG00000005619 transcript:ENSCAFT00000047227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSAGGARSPEPPKSPSEEGPPEWGTGSPPGVPGPQEGLRPMSDSGGAAFRVAKVSFPAY
LASPAGSRGSSRYSSTETLKDEDPWASRGSGGWGMYRSPSFGAGEGLLLRPQPRLRTKGA
VGTTRALRDGGLELDQSRQRKSLSNPDIASETLTLLSFLRSDLSELRVRKPSGRPSDLGS
SPLDGRDSPSAGGPGAQLGPVPAPAPASPGTRPTLKDLTATLRRAKSFTCSEKPMARRLC
RTSTLKPSSSELLLAGPSAEEDPLPLVVQDQYVQEARQVFEKIQRMGAQQDDGSDVPPGS
PDWAGDVTQGQRSQEELSGPESSLTDEGIGADPEPLVSAFCSLGTTGVWRPLSSSSAQTN
HHGPGAEDSLGGWALVSPDTPPTPGALRRRRKVPPSGPGGTELSNGEAGEAYRSLSDPIP
QRHRAATSEEPSGFSVDSNLLGSLSPKAGLPVAPAVDEGLTSGHSDWSVGSEESKGYQEV
IQSIVQGPGALGRVVDDRVAGKAPKKKSLSDPSRRGELAGPGFEGPGGEPIREVEPMLPP
SSSEPILAERRAEPEEPSAARGRAQSERALPKTRAASSTAHRDFHLDPKLADVLSPRLIR
RGSKKRPARSSHQELQREEADEDQTSSLSRARPSSKHVRHASVPATFTPIVVPEPPTSIG
PPVAVPEPVGFPARAHSTLQAPSLEDVTKQYMLTLHSGEVPAPVPVDMPCLTPVALPSAE
AKPPETARAPDEPAQASKCCSKPQVDMRKHVTMTLLDTEQSYVESLRTLMQGYMQPLKQP
ENSLLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCVQTWHAQQKVGDLLVQSFSKDVLVN
IYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQALSDLMIKPVQRIPRYELL
VKDLLKHTPEDHPDHPLLLDAQRNIKQVAERINKGVRSAEEAERHARVLQEIEAHIEGME
DLQAPLRRFLRQEMVIEVKAVGGKKDRSLFLFTDLIVCTTLKRKSGSLRRSSMSLYTAAS
VIDTASKYKLLWKLPLEDADIIKGASQATNRENIQKAINRLDEDLTTLGQMSKLSESLGF
PHQSLDEALRDLSAAMHRDLSEKQALCYALSFPPTKLELCATRPEGTDSFIFEFPHPDAR
LGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRSGMQFSCAAPTQSSCPEPMPEVWVC
NSDGYVGQVCLLSLRAEPDVEACIAVCSARILCIGAVPGLQRRGHREQPASLRNPPETAM
ETPGPELDVEATDEEAATLAEPGPQPCLHISIAGSGLEMAPGPAGGDPRPELVPFDSDSD
DESSPSPSGTLQSQASRSTISSSFGNEETPSSKEATAETTSSEEEQEPGFLPLSGSFGPS
GPCSTSPMDGRALRRSSHGSFTRGSLEDLLSVDPEAYQSSVWLGTEDGCVHVYQSSDSIR
DRRNSMKLQHAASVTCILYLNNQVFVSLANGELVVYQREAGHFWDPQNFKSVTLGSQGSP
ITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHTFYVGQDSSRSVACMVDSSLGVWVTLKGS
AHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALLVCEELLWVGTSA
GVVLTMPTSPSTVSCPRAPLSPAGLGQGHTGHVRFLAAVQLPDGFNLLCPTPPPPPDTGP
EKLPSLEHRDSPRNRGPASARPKMLVISGGDGYEDFRLSSGGGGSSETVGRDDSTNHLLL
WRV
Download sequence
Identical sequences J9PAI0
ENSCAFP00000042807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]