SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000043030 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000043030
Domain Number 1 Region: 66-166
Classification Level Classification E-value
Superfamily Cyclin-like 6.81e-30
Family Transcription factor IIB (TFIIB), core domain 0.0048
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily Cyclin-like 3.71e-16
Family Transcription factor IIB (TFIIB), core domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000043030   Gene: ENSCAFG00000018408   Transcript: ENSCAFT00000046229
Sequence length 562
Comment pep:known_by_projection chromosome:CanFam3.1:8:72588216:72621140:-1 gene:ENSCAFG00000018408 transcript:ENSCAFT00000046229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSKHLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELC
INAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLV
AARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTVDEFMRIDLEGECDPPSYT
AGQRKLRLKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGALATLTRDGSVEDT
TSSLFGEEDPEDEELEAVASHLNKDFYQELLGDSISSSSEVAGGAEGGSRPPALESLLGP
LPTAASLGISDSIRECISSQSQDPTDPCGDGELDLSGIDDLEIDRYILNEAEARVKAELW
MRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQASTAGEAIEKMLEQKKI
SSKINYSVLRDLNSKGGGSVPGEDTRAEERASARKLSRRKTPASRSGADPVTSVGKRLRP
MVSAQPAKKAAVGETVLPSPPALGAEAVRPAAVVESGPVSYHPEEDPDEEDPDEEDGEPC
VSALQMMGSNDYGCDGEEDDGY
Download sequence
Identical sequences J9PB52
ENSCAFP00000043030 XP_005623946.1.84170 XP_005623949.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]