SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000043149 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000043149
Domain Number 1 Region: 80-176
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-18
Family PDZ domain 0.0000203
Further Details:      
 
Domain Number 2 Region: 14-47
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000574
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000043149   Gene: ENSCAFG00000032311   Transcript: ENSCAFT00000044922
Sequence length 258
Comment pep:novel chromosome:CanFam3.1:10:16645289:16653920:-1 gene:ENSCAFG00000032311 transcript:ENSCAFT00000044922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCPDGSLASVPPVLSIGEGGFWEGTVKDRTGWFPADCVEEVQMRQYDTRHETREDRTKR
LFRHYTVGSYDSLTSHSDYVIDDKVAVLQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPA
LQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVGHKQVVALIRQGGNRLVMKVVSVTR
KPEEDGARRRAPPPPKRAPSTTLTLRSKSMTAELEELGEQQGWTVGRQPRGGGQAVSAGA
IARQRQKGGRTDIWTGQR
Download sequence
Identical sequences J9PBG9
ENSCAFP00000043149 ENSCAFP00000043149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]