SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000043153 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000043153
Domain Number 1 Region: 572-614
Classification Level Classification E-value
Superfamily F-box domain 0.00000209
Family F-box domain 0.011
Further Details:      
 
Domain Number 2 Region: 34-97
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00000242
Family SIAH, seven in absentia homolog 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000043153   Gene: ENSCAFG00000011512   Transcript: ENSCAFT00000047513
Sequence length 712
Comment pep:known_by_projection chromosome:CanFam3.1:33:24880530:24896880:1 gene:ENSCAFG00000011512 transcript:ENSCAFT00000047513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRARRPLPGRHRHCEKCFNRHCHVPVEPDVSCLVINCHLSCGATFHMCKEAEHELLCPL
EEVPCLNSEYGCPLSMSRHKLAKHLQVCPASVVCCSMEWNRWPNVDSETTLHENIMKEAP
SEECLDTALALQDQKVLFRSLKMVDLFPETREPTEEGPPVNGEAGREEPGGAVGGPHAGL
VPRGPLSAAGGQTAELSQEEREALAKTKEGMDLAKFDKWENIFSKEHAASALTGSSANCE
GRGGDGPEKEQSPSHSNGVGAGENTLRETEARGEQRQRDVPAALETTGLAPWQDGVLERL
KTAVDAKDYNMYLVHNGRMLIHFGQMPACTPKERDFVYGNLEAQEVKTVYTFKVPVSYCG
KRARIGDAMLSCKPSEHKAVDTSDLGITVEDLPKSDLIKTTLLCALERELKGHVISESRS
IDGLFMDFATQTYSFEPEQFSSGTVLADLLTTANPGGLHVELHSECVTRRHNKSSSAFTF
TCNKFFRRDEFPLHFKNVHTDIQSCLNGWFQHRCPLAYLGCTFIQNHFRPPGQKAKVIYS
QELKTFAIKPEVASELSERKKNSHLSGHGGKNQNSLTSLPLEVLQYIAGFLDSISLSQLS
QVSVLMRNICATLLQERGMVLLQWKKKRYSHGGTSWKVHREIWQFSSLFSKIKSWEFNEV
ASMSEHLKACPFNVVEHKTDPILLTSMCQLQEQPRESLVTTFRARPRGRHVC
Download sequence
Identical sequences J9PBH3
XP_005639605.1.84170 ENSCAFP00000043153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]