SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000043186 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000043186
Domain Number 1 Region: 77-257
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.71e-51
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000734
Further Details:      
 
Domain Number 2 Region: 30-81
Classification Level Classification E-value
Superfamily SH2 domain 0.00000918
Family SH2 domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000043186   Gene: ENSCAFG00000028544   Transcript: ENSCAFT00000046979
Sequence length 261
Comment pep:novel chromosome:CanFam3.1:5:56283489:56352982:1 gene:ENSCAFG00000028544 transcript:ENSCAFT00000046979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHFQVRGGIRLGCDSRKGPWIGPSCLPTSQGGKYDIGGGERFDTIRDVVERYRKNPMVE
KSGIVVHLKQPLKATRINAASIESRVQELNRAADASEKAKQGFWEEFEMLQQQECRLLYP
RKEGQRLENKPKNRYKNILPFDTTRVTLHDVDDNVPGADYINANYIRSDPEAKPGHGLGK
VYIATQGCLQTTVAAFWAMVYQENTRVIVMATREVERGRNKCFRYWPELHGSQEYGCVRI
CNLAEYQAQGYCVRELQGWGA
Download sequence
Identical sequences J9PBK6
ENSCAFP00000043186 ENSCAFP00000043186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]