SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000043198 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000043198
Domain Number 1 Region: 108-355
Classification Level Classification E-value
Superfamily Kelch motif 9.29e-41
Family Kelch motif 0.023
Further Details:      
 
Domain Number 2 Region: 39-84
Classification Level Classification E-value
Superfamily F-box domain 0.000000000068
Family F-box domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000043198   Gene: ENSCAFG00000031747   Transcript: ENSCAFT00000049392
Sequence length 717
Comment pep:known_by_projection chromosome:CanFam3.1:2:81357643:81460266:1 gene:ENSCAFG00000031747 transcript:ENSCAFT00000049392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSDSEDDSFMAVDQEEAVLEGTMEQDEDPHPALEAEEMRHNRSMSELPEEVLEYILS
FLSPYQEHKTAALVCKQWYRLIKGVAHQCYHGFIKAVQEGHIQWESRTYPYPGTPITQRF
SHSACYYDANQSMYVFGGCTQSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLV
VYKDLLVLFGGWTRPSPYPLHQPERFFDEIHTYSPSKNWWNCIVTTHGPPPMAGHSSCVI
DDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSPHPRGGQSQIVIDDATILILG
GCGGPNALFKDAWLLHMHSGPWAWQPLKVENEDHGAPELWCHPACRVGQCVVVFSQAPSG
RAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTP
SSSREGSLSPARGDGSPILNGGNLSPGTAAIGGSSLDSPVQAVSPSTPSTTEGYDLKMGL
SLASRRGSLPDQKDLRLGSIDLNWDLKPTSSSNHMDGVDNRTVGGSMRHPPEQTNGVHTP
PHVASALAGAVSPGALRRSLEAIKAMSSKGPSASAALSPPLGSSPGSPGSQNLSSGETVP
VPRPGPAQGDGHSLPPIARRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRV
KWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR
Download sequence
Identical sequences J9PBL7
ENSCAFP00000043198 XP_852026.1.84170 9615.ENSCAFP00000023428 ENSCAFP00000043198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]