SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000043201 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000043201
Domain Number 1 Region: 7-154
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-44
Family DBL homology domain (DH-domain) 0.000000815
Further Details:      
 
Domain Number 2 Region: 162-290
Classification Level Classification E-value
Superfamily PH domain-like 2.25e-35
Family Pleckstrin-homology domain (PH domain) 0.0000127
Further Details:      
 
Domain Number 3 Region: 388-444
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000245
Family SH3-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000043201   Gene: ENSCAFG00000019001   Transcript: ENSCAFT00000045815
Sequence length 474
Comment pep:known_by_projection chromosome:CanFam3.1:X:109543622:109577750:-1 gene:ENSCAFG00000019001 transcript:ENSCAFT00000045815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNNIFLNSLEDCVDAPERVGPCFLERKDN
FQMYAKYCQNKPRSEAIWKKYSECAFFQECQRKLKHRLGLDSYLLKPVQRITKYQLLLKE
LLKYSKGCPGFEQLKEALDTMLDLLKSVNDSMHQIAINGYIGNLNELGKMVMQGAFSVWI
GHKKGATKMKDFARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCLKMDEVG
ITEYVKGDNRKFEIWYAGKEEVYIVQAPNVDVKMTWLKEIRSILLKQQELMTVKKRKQHN
PLMEQDQLSSQQNDERQHGSFMGAEETESEHSGTMVEVREAIASVQAEANTVWAQMSSPA
EISEDPEEWPSSYFYASYDDNEEEERPLMSPGKYKALADCRKRGPEDLLIRNGDVIQFLH
EDAEGQWLVKNLNRRKEGLIPGNTSQILIGDYRFRNAKVTGLQDSKLKTPSVFI
Download sequence
Identical sequences J9PBM0
ENSCAFP00000043201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]