SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001057 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001057
Domain Number 1 Region: 105-307,356-438,475-500
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.22e-56
Family Diacylglycerol kinase-like 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000001057
Domain Number - Region: 27-106
Classification Level Classification E-value
Superfamily PH domain-like 0.0198
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001057   Gene: ENSCAFG00000000752   Transcript: ENSCAFT00000001158
Sequence length 513
Comment pep:known_by_projection chromosome:CanFam3.1:10:19537621:19598814:1 gene:ENSCAFG00000000752 transcript:ENSCAFT00000001158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AREASCWWRWPHGARPGAGAPGGDACSVPISEIITVEETDTRGKHYGSGKWQKMEKPFAF
TVHCVKRARRHRWKWAQVTFCCAEEPLCHLWLQTLQELLDKLTSRPKHLLVFINPFGGKG
QGKRIYERKVAPLFTLASITTEIIVTERANQAKESLYEINIDKYDGIICVGGDGMFSEIL
HGLIGRTQRNAGVDQNQPRAALVPSPLRIGIIPAGSTDCVCFSTVGTNDAETSALHIIVG
DSLPMDVSSVHHNSTLLRYSVSLLGYGFYGDIIKDSEKKRWMGLIRYDFSGLKTFLSHHC
YEGTVSFLPARHTVGSPRDRKPCRAGCFVCRQSKQQLEEEQKRSLYGLENTEEVEEWKVV
CGKFLAINATNMCCACPRSPSGLSPAAHLGDGSSDLILIRKCSRFNFLRFLVRHTNQYDQ
FDFAFVEVYRVKKFQFTSSHMEEEDSDLKERGKKRFGQMCSEHPSCCCSVSNSSWNCDGE
ILSSSSIEVRVHCQLVRLFARGIEENPKEELDS
Download sequence
Identical sequences F1Q445
ENSCAFP00000001057 ENSCAFP00000001057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]