SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000001999 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000001999
Domain Number 1 Region: 909-1038,1234-1422
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.12e-51
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 2 Region: 510-599
Classification Level Classification E-value
Superfamily E set domains 8.4e-19
Family Other IPT/TIG domains 0.086
Further Details:      
 
Domain Number 3 Region: 598-701
Classification Level Classification E-value
Superfamily E set domains 3.18e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.052
Further Details:      
 
Domain Number 4 Region: 414-511
Classification Level Classification E-value
Superfamily E set domains 0.00000000000128
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 5 Region: 70-121
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000235
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 698-779
Classification Level Classification E-value
Superfamily E set domains 0.0000000574
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number 7 Region: 24-73
Classification Level Classification E-value
Superfamily Sema domain 0.0000000719
Family Sema domain 0.0096
Further Details:      
 
Domain Number 8 Region: 366-400
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000131
Family Plexin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000001999   Gene: ENSCAFG00000011756   Transcript: ENSCAFT00000002159
Sequence length 1453
Comment pep:known_by_projection chromosome:CanFam3.1:7:6868503:6979536:-1 gene:ENSCAFG00000011756 transcript:ENSCAFT00000002159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWGIIFGKATCPRLKQIRADGPPHGGVQYEMVSVLKDGSPILRDMAFSIDQRYLYIMSER
QITRVPVESCEQYTTCGECLSSGDPHCGWCALHNMCSRRDKCQRAWEPNRFAASISQCMS
LEVHPSSISVSEHSRRLSLVVSDAPDLSVGISCAFGNLTEVEGQVSGSQVICISPGPKDV
PVIPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLC
THDPTTCSFQEGRINISEDCPQLVPTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVL
NIQGAVHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVDFAVVWNGNFIIDNPQDLKVHL
YKCAAQRESCGLCLKADRKFECGWCSGERRCTLQQHCVSPSSPWLDWSSHNVKCSNPQIT
EILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAGVPCTPLPGDYIIAEQIVCEMGHA
LVGTTSGPVRLCIGECKPEFMTKSHQQYTFVNPSVLSLNPIRGPESGGTMVTITGHYLGA
GSSVAVYLGNQTCEFYGRSMNEIVCVSPPSSNGLGPVPVSVSVDRARVDNNLQFEYIDDP
RVQRIEPEWSIASGHTPLTITGFNLDVIQEPRVRVKFNGKESVNVCKVVNTTTLTCLAPS
LTTDYRPGLDTVERPDEFGFVFNNVQSLLIYNDTKFIYYPNPTFELLSPTGVLDQKPGSP
IILKGKNLCPPASGGAKLNYTVLIGETPCAVTVSETQLLCEPPNLTGQHKVMVHVGGMVF
SPGSVSVISDSLLTLPAIVSIAAGGSLLLIIVIIVLIAYKRKSRENDLTLKRLQMQMDNL
ESRVALECKEAFAELQTDINELTSDLDRSGIPYLDYRTYAMRVLFPGIEDHPVLRELEVQ
GNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYA
TDVLKQLLSDLIEKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFML
YCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLN
CDTITQVKEKILDAIYKNVPYSQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRL
NTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISRYDSSFRYTGSPDSLRSRAPMI
TPDLESGVKVWHLVKNHDHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFS
TVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDI
HKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAKL
PAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAY
KVEQLINAMSIES
Download sequence
Identical sequences F1PKX9
ENSCAFP00000001999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]