SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000002807 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000002807
Domain Number 1 Region: 215-547
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.3e-111
Family Motor proteins 0.0000000428
Further Details:      
 
Domain Number 2 Region: 3-67
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000171
Family SAM (sterile alpha motif) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000002807   Gene: ENSCAFG00000001909   Transcript: ENSCAFT00000003025
Sequence length 1365
Comment pep:known_by_projection chromosome:CanFam3.1:11:50976627:51022382:-1 gene:ENSCAFG00000001909 transcript:ENSCAFT00000003025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSWLYECLCEAELAQYYPHFTALGLRKIDELANVTMKDYSKLGVRDMNDRKRLFQLIKI
IKIMQEEDKEVGSPEHPLQTNRLCSKPWESRSGPRRQLHFDSPADDKDRTTNNNGFEMCS
LSDFSVNEQKSSYLKVLEHILPDDSHYHTKTRILNATAAGSYVQTETNTSLFSSNHFSPI
LGDYDIPIIQRISHVSGYNYGIPRSCSRQNTSEKENPWTEMEKIRVCVRKRPLGMREVRR
GEINIVTVKDKETLLVHEKKEAVDLTQYILQHVFYFDEVFGEACTNRDVYMKTTHPLIQH
IFNGGNATCFAYGQTGAGKTYTMIGTHQNPGLYALAAKDIFRQLEVSQPRRHLFVWISFY
EIYCGQLYDLLNRRKRLFAREDSKHVVQIVGLQELQVDSVELLLEVILKGSKERSTGATG
VNADSSRSHAIIQIQIKDSAKRTFGRISFIDLAGSERAADARDSDRQTKMEGAEINQSLL
ALKECIRALDQEHTHTPFRQSKLTQVLRDSFIGDAKTCMIANISPSHVATEHTLNTLRYA
DRVKELKKGIKCCASATSQNRTSGNSSPKRIQSSPMALPGDKCSPKKVKLGLQQTFTASP
GSMRGKAHPLASHPPNIPFAPVPKVPGKRGGSRRSLPQEWGIQTSPPRGATRSGHLARKR
AEESVSLCSEKNQMGNKTAHRWESRAPGPREAPAHGKLPSKCKPGQTVRPVQKQLVSPAE
LSSGRPQHSAEHNQGSQGSTSARSASETWTNIPSHQKEREEHLRFYHQQFQQPPLLQQKL
KYQPLERFLCQYRPLEGQLQIETPPPFCSHSESQDGAQAEDLDDSDFSEDSFSHVSSQRT
TEQRSTLEDSEGSFFLHQREQGPEEQVAERQQSLLFNPRTDGDEKGLTGNWMYSRDPTNH
RRAALSHGLSPSKVPLDWSREEESTSLGLSPRDNLAEKPYCSQIDFVHGQKRDGGPASDL
RQNTFRSEVPEQAEVSSLSPEEDGFPLSLSHGAVQGAGDQRNTVSTPLREDGQDSPTLVT
KTLKNGYPYQEDHRGESGTCSECASGLMAPLTVSLLENTDDEGPLPSEQLAQDETAHSLE
ATEGPPMGHTMSSDDQKALLPVSLATGHLWLSSSPPDNKPGGSLPALSPSPIRQHPPDKL
PFSEADLEEVSQSRETAHSSQEQMGSQQYDADAEATELSSFQEFPGKPFTIHTGGPHPAT
ILTPQTESNDMADQPWAQERKHPTGLGWQELVSLSRDPIKLPCYNRDIMWLKYRPIPRCL
ARPGSPLVPGCSPKTTGTLHQLTLGHAQQVVIQAHQEQLDRMAELGFKEETLLSQLALND
FEDFVTQLDEILALKSKCIQSLRSQLQLYLTCHRPTTVPERTVVS
Download sequence
Identical sequences E2RC91
XP_005626772.1.84170 XP_538707.3.84170 ENSCAFP00000002807 ENSCAFP00000002807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]