SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004327 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004327
Domain Number 1 Region: 158-268
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 301-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 3 Region: 270-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000151
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000004327
Domain Number - Region: 337-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00048
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 40-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000754
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004327   Gene: ENSCAFG00000002919   Transcript: ENSCAFT00000004675
Sequence length 502
Comment pep:known_by_projection chromosome:CanFam3.1:10:56632531:56694505:-1 gene:ENSCAFG00000002919 transcript:ENSCAFT00000004675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETPAAEGVGAAANAAAASGTGTGTVAASGMATSG
VMPGGGFVASAAAVAGPEVQTGRNNFVIRRNPADPQRIPSNPSHRIQCATGYEQSEHNVC
QDIDECTAGTHNCRADQVCINLRGSFACQCPQGYQKRGDQCVDIDECTIPPYCHQRCVNT
PGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLN
CEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCW
NYHGGFRCYPRNPCQDPYVLTSENRCVCPVSSAVCRELPQSIVYKYMSIRSDRSVPSDIF
QIQATTIYANTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREYIVDLEMLTVN
SIGTFRTSSVLRLTIIVGPFSF
Download sequence
Identical sequences E2R612
ENSCAFP00000004327 ENSCAFP00000004327 9615.ENSCAFP00000004327 XP_005626175.1.84170 XP_005626176.1.84170 XP_531834.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]