SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004775 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004775
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily PDZ domain-like 1.06e-24
Family PDZ domain 0.0017
Further Details:      
 
Domain Number 2 Region: 78-208
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-19
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000004775
Domain Number - Region: 227-350
Classification Level Classification E-value
Superfamily PH domain-like 0.00705
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004775   Gene: ENSCAFG00000003214   Transcript: ENSCAFT00000005158
Sequence length 460
Comment pep:known_by_projection chromosome:CanFam3.1:17:684404:764470:1 gene:ENSCAFG00000003214 transcript:ENSCAFT00000005158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHRTVTLRRQPGGSLGLSIKGGAEHRVPVVISRMFRGHTADRTGMLFVGDAILQVNGINV
ENATHGEVVHLLRSAGDEVTITVEYLRDAPSFLNLPSGSPGPAGDHGSGACSPLFDSGLH
LNGDPSSTAPSSPSSPVANEPKYEKRWLDTLSVPLSMARISRHKAGAETLRCSAFEVLAL
DGVSTGILQFRSAQEGAAWLRAVSANIRDLTLQSVRMANKCCSSCDQVVHMGWVIERLKD
TGSCQTCCSKFLVLKGSSLHVFSTPPVSTLDWGRAEETYNLCEVLFKLHKVGVLHDCWLH
ADSGLEPWGLEDPQPYCFSVLVGHGQSRRFSVELGSELAAWATSFQRATFMEVQRAGSRT
YTCSWQGDPLCFTVDFALGFTCYDSKTKNVLWRFKFSQLKGSSDDGNTRVKLLFQHLNSR
QIEVKELEFQDLTAVLHCVHAFLAAKVASVDPAFVDSQSI
Download sequence
Identical sequences F1Q0F3
ENSCAFP00000004775 ENSCAFP00000004775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]