SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000004842 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000004842
Domain Number 1 Region: 27-90
Classification Level Classification E-value
Superfamily F-box domain 2.62e-19
Family F-box domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000004842   Gene: ENSCAFG00000003261   Transcript: ENSCAFT00000005231
Sequence length 141
Comment pep:known_by_projection chromosome:CanFam3.1:10:67451430:67451855:-1 gene:ENSCAFG00000003261 transcript:ENSCAFT00000005231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKNSKRNNNSRVSDLELNAADAEKEKKEGQNNFVELLPPEVTFKIFSQLDIRSLCRASI
TCRSWNNTVRDSDSLWKPHCLTLRAVCQREIDNDVESGYSWRVSVVSVVCSVLDNVVAGV
SPLYLLHGGGRISYQSVGFWS
Download sequence
Identical sequences E2R8A9
ENSCAFP00000004842 ENSCAFP00000004842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]