SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000005199 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000005199
Domain Number 1 Region: 6-136
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.7e-19
Family Laminin G-like module 0.08
Further Details:      
 
Domain Number 2 Region: 228-347,411-479
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000000498
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 359-520
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000698
Family Reprolysin-like 0.05
Further Details:      
 
Domain Number 4 Region: 1272-1335
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000181
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number 5 Region: 1208-1280
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000375
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 6 Region: 1146-1212
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000124
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 7 Region: 1077-1150
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000334
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000005199
Domain Number - Region: 745-800
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00292
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000005199   Gene: ENSCAFG00000003488   Transcript: ENSCAFT00000005614
Sequence length 1489
Comment pep:known_by_projection chromosome:CanFam3.1:11:70015167:70214502:1 gene:ENSCAFG00000003488 transcript:ENSCAFT00000005614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLYDKCSYTSRDRGWVVGIHTVSDQGNRDPRYFFSLKTDRARQVTTINAHRSYVPGQWVH
LAATYDGRLMKLYVNGAQVATSGEQVGGIFSPLTQKCKVLMLGGSALNQNFRGYIEHLSL
WKVARTQREVLLDMESHGLHAPLPQLLLQENWDNVKRTWSPMKDGHMPHVEVSGAHGFLL
DTSLEPPLCGQTLCDNTEVIASYNQLPRFRRPKVVRYRVVNLRDDDRENPTVSRQQIDFQ
HRQLADAFKHYNISWELQVLEVSNSSLRRRLVLANCDISKIGDENCDHECNHTLTGHDGG
DCRNLRHPAFVKKQHNGVCDMDCNYERFNFDGGECCNPEITDVTKTCFDPDSPHRAYLDV
NELKNILRLDGSTHLNIFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGIPGHTH
TMIHEIGHSLGLYHIFRGISEIQSCSDPCMETEPSFETGDLCSDTNPAPKHKFCGDPGPG
NDTCGFHSFFNTPYNNFMSYADDDCTDSFTPNQVARMHCYLDLVYQSWQPSRKPAPVALA
PQIVGHTTNSVTLEWFPPDGHFFERELGSACELCLEGRILVQYAINASSPMPCGPSGHWS
PREAEGHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFRYPLVPESLTIW
VTFVSTDWDSSGAVNDIKLLTVSGKNISLGPQNVFCDVPLTIKLRDVGEEVSGIQIYTLD
EHLEIDAAMLTSIADSPLCLECKPLQYKVVRDPPLHVDVASLLHLHRRFTDTDLSLGSTY
QYWVITISGSEESEPSPAAIYIHGSGYCGDGIIQKSQGEECDDMNKLNGDGCSLFCRQED
SFNCIDEPSRCYFHDGDGVCEEFEQKTSIKDCGVYTPQGFLDQWASNASVSHQDQQCPGW
VIIGQPAASQVCRTKVIDLSEGISQHAWYPCTISYPYYSQMAQTTFWLRAYFSQPMVAAA
VIVHLVTDGTYYGDQKQETISVQLFDTKDQSHDLGLHVLSCRNNPLIIPVVHDLSQPFYH
SRAVRVSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSSAEQSCVHFACEAADCPEL
AVENASLNCSSSDRYHGARCTVSCRTGYVLQIQRDDELIKSQVGPSVTVTCSEGKWNKQV
ACEPVDCGIPDQHHVYAASFSCLKGTTFGSKCSFQCRHPAQLKGNNSLLTCMEDGLWSFP
EALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQ
CTQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDAAQGRGSNIIHC
RKDGTWSGSFHLCQEMQGQCSAPDQLNSNLKLQCPEGYAIGSECVTSCLDHNSESIILPV
NVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNY
DGGDCCASTVKTKKVTPFPMSCDLQGDCACRDPQAQEHSRKDLRGYSHG
Download sequence
Identical sequences F1PCK1
ENSCAFP00000005199 ENSCAFP00000005199 9615.ENSCAFP00000005199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]