SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000006571 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000006571
Domain Number 1 Region: 875-980
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000108
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 590-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000454
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 3 Region: 980-1108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000691
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 782-902
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 669-779
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000816
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 6 Region: 432-538,589-633
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000895
Family Growth factor receptor domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000006571
Domain Number - Region: 130-174
Classification Level Classification E-value
Superfamily FnI-like domain 0.00356
Family VWC domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000006571   Gene: ENSCAFG00000004406   Transcript: ENSCAFT00000007096
Sequence length 1217
Comment pep:known_by_projection chromosome:CanFam3.1:20:3874955:3934614:1 gene:ENSCAFG00000004406 transcript:ENSCAFT00000007096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLRAPAGAWLALTLALALGPSSGGAAPRQDCTGVECPPLENCIEEALEPGACCATCVQ
QGCACEGYQYYDCLQGGFVRGRVPAGQSYFVDFGSTECSCPPGGGKISCQFMLCPELPPN
CIEAVVVADSCPQCGQVGCVHAGRKYAAGHTAHLPPCRACHCPDAGGELICYQLPGCRGN
FSDAEEGDPERHYEDPYSYDQEVAEAEAAAALAGELQAGAGGPAALGGGGQPSSAIQDTP
WPAALPRPTAAAALGPPAPVQTKARRVTEDSQGEGQAGAEELAVREQPAAGGPRGLDGLP
TVDPAGPHLPAQEGTAAAGVGPEENLIPDAQATLRSAGQEGAGPIPESSTAGVPPSQATP
HSPGGTTKPSTHTVLTTSPEEAPWVPPTQEVPKQPPVLPRVQPAEDTDPNSVHSVPRGDP
EVSTKDLIETCCAAGQQWAIDNDECLEIPESGAEGDACRTAQKHCCVSYLKEKSCMAGVM
GAKEGESCGAEDNDTCGVSLYKQCCDCCGLGLRVRAEGHSCESNPNLGYPCNHVMLSCCE
GEDPLIVPEVRRPPEPEAAPRRVSETELANREALSLGTETELPNSLPGDDQDECLLLPGE
LCQHLCINTVGSYHCACFPGFSLQDDGRTCRPESDPPQPEAAEESAVKPESSQVASNTIM
LPVPQPNTCKENGPCKQVCSVIGDTAMCSCFPGYAIMADGVSCEDQDECLMGTHDCSLRQ
FCVNTLGSFYCVSHTVLCAKGFILNRHRKCVDINECVTDLHSCSRGEHCVNTVGSFRCYQ
ALTCEPGYALKDGECTDVDECELGTHNCQVGFTCQNTKGSFYCQARQRCMEGFLQDPEGN
CVDVNECTSLSEPCRSGFSCINTVGSYTCQRNPLLCGRGYHANQDGTKCVDVNECETGVH
QCGEGQVCHNLPGSYRCDCKAGFQRDAFGRACIDVNECWTSPGRLCQHTCENTLGSYRCS
CASGFLLAADGKHCEDVNECETQRCSQECTNIYGSYQCYCRQGYQLAEDGHTCTDIDECA
QGAGILCTFRCVNVPGSYQCACPERGYTMTANGRSCKDLDECALGTHNCSEAETCHNIRG
GFRCLRFECPPNYVRVSETKCERTTCHDFMECQNSPARITYYQLNFQTGLLVPAHIFRIS
PVPVFAGDTISLAITKGNEEGYFGTRPLNAYTGVVYLQRLVREPRDFALDVEMKLWRQGS
VTTFLAKMHIFFTTFAL
Download sequence
Identical sequences F1PRU3
ENSCAFP00000006571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]