SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007001 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007001
Domain Number 1 Region: 542-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.85e-26
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 598-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.26e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 654-710
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 374-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.06e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 486-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 430-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 17-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 710-766
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 331-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.73e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 751-803
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 11 Region: 236-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000873
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 12 Region: 292-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000132
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007001   Gene: ENSCAFG00000023881   Transcript: ENSCAFT00000007560
Sequence length 812
Comment pep:known_by_projection chromosome:CanFam3.1:1:111094006:111105322:-1 gene:ENSCAFG00000023881 transcript:ENSCAFT00000007560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPQDSDLPQKEQEKMTKFQEVVTFKDVAVVFTIEELGLLDSTQRKLYRDVMVENFKNLV
SVGHLPFKPDMVSQLEAEEKRWMMERETQRNGYSSEDHVTVPSGSKNQNEMETLRKVALK
FLSNEELSCWQIWKQVASNLTRCLQRKRSQLQQGNSIQVSENENSVMNHKGNGSAYTANQ
ELSISRTQDSSGNTYFHESQNQSKGQQVNTKNNQHISEAFMKKSPLNDHINIDTEQKPYI
FNKCGKSISDSFNQRIPPRQEFHPCRECGKGVNYSSVLLLHQNVHTREKCSSQSSHLQTH
QRIRPREKLNKYHESGDCFKKSTFHPHQSHHTGEKSYRCDSCGKGFSSSTGLIIHYRTHT
GEKPYKCEECGKCFSQSSNFQCHQRVHTEEKPYKCEECGKGFGWSVNLRVHQRVHRGEKP
YKCEECGKGFTQAAHYHIHQRVHTGEKPYKCDVCGKGFSHNSPLICHRRVHTGEKPYKCE
ACGKGFTRNTDLHIHFRVHTGEKPYKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGK
GFSQSSKLQTHQRVHTGEKPYKCDVCGKDFSYSSNLKLHQVIHTGEKPYKCEECGKGFSW
RSNLHAHQRVHSGEKPYKCEECDKSFSQAIDFRVHQRVHTGEKPYKCDVCGKGFSQSSGL
QSHQRVHTGEKPYKCDVCGKGFRYSSQFIYHQRGHTGEKPYKCEECGKGFGRSLNLRHHQ
RVHTGEKPHRCEECGKAFSLPSNLRVHLSVHIREKLFKCEECGKGFSHSLRLQAHQRVHT
GEKPYKCDICGKDFNHHSRLKYHQKVHTGRNR
Download sequence
Identical sequences E2RHJ1
ENSCAFP00000007001 XP_005616539.1.84170 XP_013975342.1.84170 XP_013975347.1.84170 ENSCAFP00000007001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]