SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007243 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007243
Domain Number 1 Region: 119-179
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000656
Family B-box zinc-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 18-111
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000801
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000007243
Domain Number - Region: 184-235
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0791
Family Spectrin repeat 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007243   Gene: ENSCAFG00000004835   Transcript: ENSCAFT00000007815
Sequence length 366
Comment pep:known_by_projection chromosome:CanFam3.1:17:21257075:21279991:1 gene:ENSCAFG00000004835 transcript:ENSCAFT00000007815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQASNP
LWQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRPLHSKA
EQHLMCEEHEEEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQKSELSDGIAM
LVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFEALCSVLEERKAELLQALAREQE
EKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGTMSKVELAG
RPEPGYESMEQFTVSVEHVAEMLRTIDFQPGASGEEEDEEVALDGEEGSAGPEEERPDGP
EGTGGH
Download sequence
Identical sequences E2RL94
ENSCAFP00000007243 XP_005630313.1.84170 ENSCAFP00000007243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]