SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007497 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007497
Domain Number 1 Region: 9-149
Classification Level Classification E-value
Superfamily Cyclin-like 2.33e-43
Family Cyclin 0.000000227
Further Details:      
 
Domain Number 2 Region: 150-253
Classification Level Classification E-value
Superfamily Cyclin-like 5.53e-35
Family Cyclin 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007497   Gene: ENSCAFG00000005031   Transcript: ENSCAFT00000008096
Sequence length 733
Comment pep:known_by_projection chromosome:CanFam3.1:19:37743488:37783130:1 gene:ENSCAFG00000005031 transcript:ENSCAFT00000008096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGRGASSRWFFTREQLENTPSRRCGVEADKELSYRQQAANLIQDMGQRLNVSQLTINT
AIVYMHRFYMHHSFTKFNRNIISPTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDT
KCDAYLQQTQELVLLETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNS
LHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEF
LQILEKTPSRLKRIRNWRANQAAKKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPS
FQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYSLSSHQEWPQHQESART
EQIYSQKQETSLSGSQYNINFQQGPSISLHSGLHHRPDKISDHSSIKQEYTHKAGSSKHH
GPISATPGVIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKHVQSQSASSSSVTS
PIKMKIPITNTEKPEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSS
SDEGSGKSKHSSPHISRDHKEKHKDHPSNRHHPSSHKHSHSHSGSSSGGSKHSADGIPPT
VLRSPVGLSSDGISSSSSSSRKKLHVNDASHNHHSKMSKSSKSSGSSSSSSSSVKQYISS
HNSVFNHPLPPPPPVTYQVGYGHLSTLVKLDKKPVETNGPDVNHEYSTNSQHMDYKDTFD
MLDSLLSAQGMNM
Download sequence
Identical sequences E2RNV5
ENSCAFP00000007497 ENSCAFP00000007493 9615.ENSCAFP00000007497 XP_533333.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]