SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007696 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007696
Domain Number 1 Region: 280-528
Classification Level Classification E-value
Superfamily SIS domain 6.67e-20
Family mono-SIS domain 0.0073
Further Details:      
 
Domain Number 2 Region: 29-278
Classification Level Classification E-value
Superfamily SIS domain 0.0000000381
Family mono-SIS domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007696   Gene: ENSCAFG00000005150   Transcript: ENSCAFT00000008303
Sequence length 625
Comment pep:known chromosome:CanFam3.1:17:21434251:21459925:1 gene:ENSCAFG00000005150 transcript:ENSCAFT00000008303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSTKRFQHVIETPEPGKWELSGYEAALPITEKSNPLTQDLDKADAEQIVRLLGQCDAEI
FQEEGQIMPTYQRLYSESVLTTMVQVAGKVQEVLKEPEGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKPLYTYLIAGGDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISV
GLSAPFVAGQMDYCMDNPAIFLPVLVGFNPVNMARNDPIEDWSSTFRQIAERMQKLQEKQ
EAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDRGIAASQRCLLEILRTFE
RAHQVTYSQSTKIAALMKQASSSLEKKGRVYLVGWQTLGIIAIMDGVECIHTFGADFQDV
RGFLIGDHSDMFNQKAELINQGPQFCFSQEDFLTSILPSLTEIDTVVFVFTLDDNLTEVQ
TLVEQVKEKTANIQALAHSTVGQSLPTPLKKLFPSIISIMWPLLFFEYEGNFIQKFQHEL
STKWILNTVSTGAHVLLGKILQNHMLDLRIRNSKLFWRALAMLQRFSGQPKARCIETLLQ
VIHFPQPLSDDIRASPISVHIQTAHEKEQVIPIALLSLLFRCSILEAQAHLAAAPSVCEA
VRSALTGPGRKRSTDPLEALEPALL
Download sequence
Identical sequences F1PCS9
NP_001273995.1.84170 ENSCAFP00000007696 ENSCAFP00000007696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]