SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007801 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007801
Domain Number 1 Region: 363-504,537-755,795-866
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.77e-53
Family Tandem AAA-ATPase domain 0.035
Further Details:      
 
Domain Number 2 Region: 135-190
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000719
Family F-box domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007801   Gene: ENSCAFG00000005218   Transcript: ENSCAFT00000008418
Sequence length 972
Comment pep:known_by_projection chromosome:CanFam3.1:2:30048760:30085177:-1 gene:ENSCAFG00000005218 transcript:ENSCAFT00000008418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSNSVGQDTSKDSEGEMIFAAESNCALPQEGDGEVRLGSSGSALSARKRSRSFEDDRN
QATGTSQWDGVSKKTPRHRLSLSCTRPREARQEAGDSLSRCSAESGEPSQQMEDIGLDPI
PDSYYGLLGTLPCQEPQSHICSLPSEVLRHIFAFLPVEDLYWNVSLVCHLWREIILDPLF
IPWKKLYHRYLMNEEQAVSKVDGILLNYGIEKESDLCVLNLIRYTATTKCSPSVDPGRAL
WSLRDHPLLPEAEACVRQHLPDLYVAAAGVNVWALVAAIVLLSSSVNDVQQLLFCLRRPS
STVTMPDITETLYCIAVLLYAMREKGINISNRIHYNIFYCLYLQENSCTQATEVKEEPSV
WPGKKTTIQLTHEQQLILSHKMEPLQVVKIMAFAGTGKTSTLVKYAEKWSTSRFLYVTFN
KSIAKQAELVFPSNVTCKTFHSMAYGHVGRKYQLKKKLNLFKLTPFMVNSVLAEGKGGFI
RAKLVCKTLENFFASADEELTIDHVPIWCKNSQGQRVMVEQSEKLNGVLEASRLWDNMRK
LGECKEEAYQMTHDGYLKLWQLSKPLLASFDAIFVDEAQDCTPAIMNIVLSQPCGKIFVG
DPHQQIYTFRGAVNALFTVPHTHVFYLTQSFRFGVEIAYVGATILDVCKRVRKKTLVGGN
HQSGIRGDAKGQVALLSRTNANVFDEAVRVTEGEVPARIHLIGGIKSFGLDRIIDIWILL
QPEEERKKQNLVIKDRFIRRWVHREGFSGFKRYVTAAEDKELEAKIAVVEKYNIRIPELV
ERIEKCHIEDLDFAEYILGTVHKAKGLEFDTVHVLDDFVKVPCARHNLAQLPHFRVESFS
EDEWNLLYVAVTRAKKRLIMTKSLENILTLAGEYFLQAELTSNVLKTGVVRCCVGQCNNA
IPVDTVLTMKKLPITYSNRKENKGGYLCHSCAEQRIGPLAFLTASPEQVHSMERTVENVV
LPRHEALLFLVF
Download sequence
Identical sequences F1P8M0
ENSCAFP00000007801 ENSCAFP00000007801 XP_013961754.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]