SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007917 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007917
Domain Number 1 Region: 32-129
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 176-223
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000536
Family SOCS box-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007917   Gene: ENSCAFG00000005306   Transcript: ENSCAFT00000008545
Sequence length 225
Comment pep:known chromosome:CanFam3.1:9:2859267:2859944:1 gene:ENSCAFG00000005306 transcript:ENSCAFT00000008545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPPGAPSFPAPPTEPSSEVSEQPPSQPLPGNPPRRAYYIYSGGEKIPLVLSR
PLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Download sequence
Identical sequences F1PZ18
ENSCAFP00000007917 ENSCAFP00000007917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]