SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009205 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009205
Domain Number 1 Region: 578-869
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.9e-79
Family Protein kinases, catalytic subunit 0.0000251
Further Details:      
 
Domain Number 2 Region: 418-532
Classification Level Classification E-value
Superfamily PH domain-like 2.61e-34
Family Pleckstrin-homology domain (PH domain) 0.0000236
Further Details:      
 
Domain Number 3 Region: 130-205
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.94e-21
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0007
Further Details:      
 
Domain Number 4 Region: 257-322
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.5e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009205   Gene: ENSCAFG00000006119   Transcript: ENSCAFT00000009918
Sequence length 890
Comment pep:known_by_projection chromosome:CanFam3.1:17:29593816:29688217:-1 gene:ENSCAFG00000006119 transcript:ENSCAFT00000009918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSANNSPPSAQKSVLPATLPAVLPAPSPCSSPKTGLSARLSNGSFSAPSLTNSRGSEHTI
SFLLQIGLTRESVTIEAQELSLSAVKDLVCSVVYQKFPECGFFGMYDKILLFRHDMNSEN
ILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVR
QGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSFPRLLQTDYVPLPTEES
HVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYTRPTICQYCKRLLKGLFRQGM
QCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGADTDIPMDIDSSDMNSDGSRGLDDT
EEPSPPEDKMFFLDPSDLDVERDEEAVKTISPSTSSNIPLMRVVQSIKHTKRKSSTMVKE
GWMVHYSSRDTLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPQDFTNISQG
SNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGVDVAQSWEKAIRQALMPVTPQASV
CTSPGQGKDHKDLSTSISVSNCQIQENVDISTVYQIFADEVLGSGQFGIVYGGKHRKTGR
DVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDML
EMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCD
FGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIVYVSLSGTFPFNEDE
DINDQIQNAAFMYPPNPWREISGEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLD
LREFETRIGERYITHESDDARWEVHAYTHNLVYPKHFIMAPNPDDMEEDP
Download sequence
Identical sequences E2R428
9615.ENSCAFP00000009205 XP_005630396.1.84170 XP_540151.2.84170 ENSCAFP00000009205 ENSCAFP00000009205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]