SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009326 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009326
Domain Number 1 Region: 916-1092
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.0004
Further Details:      
 
Domain Number 2 Region: 489-605
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.0017
Further Details:      
 
Domain Number 3 Region: 253-379
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-25
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 
Domain Number 4 Region: 1175-1322
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-17
Family Pleckstrin-homology domain (PH domain) 0.044
Further Details:      
 
Domain Number 5 Region: 8-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000112
Family SAM (sterile alpha motif) domain 0.0038
Further Details:      
 
Domain Number 6 Region: 390-497
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000212
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 7 Region: 604-783
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000171
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 8 Region: 799-908
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000392
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 9 Region: 1132-1195
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000149
Family Ras-binding domain, RBD 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009326   Gene: ENSCAFG00000006214   Transcript: ENSCAFT00000010054
Sequence length 1542
Comment pep:known_by_projection chromosome:CanFam3.1:2:36615361:36637586:-1 gene:ENSCAFG00000006214 transcript:ENSCAFT00000010054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPQDLDIAVWLATVHLEQYADSFRQHGLATAGAARGLGHEELRQLGISATGHRKRILR
LLQAGATEGSLDPQSDSAMEPSPSLAPQAQPPKPVPKPRTVFGGLSGPTTTQWPGVSPAL
WRPEVSRSPESSPKSPPLSTSSSEQTAALNTMEMMPNAIYFGLDLRGGVQMTQNTAPDSS
QAAAPTPALRPTTGTVHIMDPGCLYYGVQPAGVPGPLERREGRGVSQDRAEHRLSRQDLE
VREDAGYASLELPGDSTLSLPTLDVETNDDLISPYASFSSTADRPTPLLSGWLDKLSPQG
NYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQVITGQRVFVFRT
ESEAQRDTWCSTLQSCLREQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPGELAL
YKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQEA
VTETLSDYEVAEKIWSNRANRHCADCGASRPDWAAVNLGVVICKQCAGQHRALGSGISKV
QSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGALPIGEGVHPDTSPGPRGEFISRKYRLG
LFRKPHPQYPDHSRLLQALCAAVAGPNLLKNMTQLLCVEATEGDEPWSPSALDGSFPGLL
IPDPSPGVYNEVVVPATYSSFLYCGPISNKAGPPPPRRGRDAPPRLWCVLRAALEMFVSE
SSPEPLSLIQPQDVVCLGVSPPPTDPGDLDRFPFSFELILTGGRIQHFGTDGADSLEAWT
SAVGKWFSPLSCHQLLGPGLLRLGRLWLRSPTHSALAPSLWLSGFGLLRGDHLFLCPAPG
PGPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFSAWNTAIE
GAAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLQLEGIYRKGGARARSLRLLAEFRR
DARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKEV
IGCLPQVNRRTLATLIGHLYRVQKCASLNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQE
LIDDYVSVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVS
PTLTAEELTNQVLEMRGTEAGMDLWVTFEIREHGELERPLHPKERVLEQALQWCQLPEPC
SASLLLRKVSLAQAGCLFTGIRRESPRVGLLRCREEPPRLLGNRFQERFFLLRGRCLLLL
KEKKSSKPEREWPLEGSKVYLGIRKKLKPPTPWGFTLILEKMHLCLSCTDEDEMWDWTTS
ILKAQHDDQQPVVLRRHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTL
SMFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELTKDTSTSFSMMREKTANPETPL
TSQRSFDKPLFPKAGGPGPEERPPEPPPGPPSKSSPQAHGSLEEQLLQELSSLILRKGET
TIGLGSPSQPSSPQSPNPNGLLTQTPGFPTQPSSSPSSQPLT
Download sequence
Identical sequences E2QXB0
9615.ENSCAFP00000009326 ENSCAFP00000009326 XP_013963450.1.84170 ENSCAFP00000009326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]